DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-Q and AT3G57170

DIOPT Version :9

Sequence 1:NP_001285323.1 Gene:PIG-Q / 117366 FlyBaseID:FBgn0086448 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_191276.2 Gene:AT3G57170 / 824884 AraportID:AT3G57170 Length:560 Species:Arabidopsis thaliana


Alignment Length:288 Identity:77/288 - (26%)
Similarity:136/288 - (47%) Gaps:48/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VFINSI-MVHTTIYKHFKEWQTACDKRSRPANIVLDRILGIILML-ILF---TLATQPGDFLIQI 250
            :|:..| |:..:..||.:|  .|..:.|..:.:.:|.:||.::.| :||   ::.:...||..:.
plant   183 IFLEEIDMMSISCVKHAEE--AALQRHSTWSAMAVDLVLGNLIGLGLLFNTESVCSFVFDFAKEF 245

  Fly   251 SHYVIDELYGLLKV----LEGSPIGLKLNIHLNNFFLDCFKYHIELWSTFLDFIEPLVRQVFLAI 311
            ::       |:|:.    |.|.|.|.|||..|...........|::|||...|:...   :|..|
plant   246 TN-------GILRSGSVWLMGVPAGFKLNTELAGVLGMVSLNVIQIWSTLWVFMASF---IFCLI 300

  Fly   312 GMIGCLGFTF----QIALLVDLISVIGLHSHCFYIYTKVLYNVERRGLSVLWQVVRGNRYNILKG 372
            .:|..||.||    ..|.::|:|:...||....:....::|:.:.:.|:.||::.||.:.|.|:.
plant   301 RVIAILGITFGATVSAAFVIDVITFATLHIMALHWAITLVYSHQIQALAALWRLFRGRKLNPLRQ 365

  Fly   373 RTESHNYMNRQLYLATIFFSAILFLLPTTLVYYIVFAALKA--------LTFATLSVFH------ 423
            |.:|:.|..:|..:.::.|:.:|.|||||.|:||.|.....        :.|| :||.|      
plant   366 RMDSYGYTVKQHVVGSLLFTPLLLLLPTTSVFYIFFTITSTTINSICMLIEFA-ISVIHATPYAE 429

  Fly   424 ----FLRRKL----MYLPIEVCIKRLLR 443
                .:|||.    ::..:|.|.:.:|:
plant   430 VMIWLVRRKRFPCGVWFEMEHCGEHILK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-QNP_001285323.1 Gpi1 240..401 CDD:282831 46/168 (27%)
AT3G57170NP_191276.2 Gpi1 207..381 CDD:282831 48/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3320
eggNOG 1 0.900 - - E1_KOG1183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247641at2759
OrthoFinder 1 1.000 - - FOG0005188
OrthoInspector 1 1.000 - - oto2921
orthoMCL 1 0.900 - - OOG6_103823
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.