DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-Q and Pigq

DIOPT Version :9

Sequence 1:NP_001285323.1 Gene:PIG-Q / 117366 FlyBaseID:FBgn0086448 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001007608.1 Gene:Pigq / 287159 RGDID:1359535 Length:581 Species:Rattus norvegicus


Alignment Length:232 Identity:80/232 - (34%)
Similarity:134/232 - (57%) Gaps:6/232 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 RPAN----IVLDRILGIILMLILFT--LATQPGDFLIQISHYVIDELYGLLKVLEGSPIGLKLNI 276
            |.||    ::||..||::|:..|.:  ...|..:.|:.::..|.:||..||:.|.|:|.|||:|.
  Rat   274 RKANMLVSVLLDVALGLLLLSWLHSNNRIGQLANALVPVADRVAEELQHLLQWLMGAPAGLKMNR 338

  Fly   277 HLNNFFLDCFKYHIELWSTFLDFIEPLVRQVFLAIGMIGCLGFTFQIALLVDLISVIGLHSHCFY 341
            .|:......|.|||.||.:::..:.|.:..:...:|:..|||.|..:::..|:|:::..|.:|||
  Rat   339 ALDQVLGRFFLYHIHLWISYIHLMSPFIEHILWHVGLSACLGLTVALSIFSDIIALLTFHIYCFY 403

  Fly   342 IYTKVLYNVERRGLSVLWQVVRGNRYNILKGRTESHNYMNRQLYLATIFFSAILFLLPTTLVYYI 406
            :|...||.::..|||.||::.||.::|:|:.|.:|.:|...||::.|:.|:.::||||||.:||:
  Rat   404 VYGARLYCLKIYGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQLFIGTLLFTILVFLLPTTALYYL 468

  Fly   407 VFAALKALTFATLSVFHFLRRKLMYLPIEVCIKRLLR 443
            ||..|:.|......:.|.|...:..||:.....||.|
  Rat   469 VFTLLRLLVITVQGLIHLLVDLINSLPLYSLGLRLCR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-QNP_001285323.1 Gpi1 240..401 CDD:282831 56/160 (35%)
PigqNP_001007608.1 Gpi1 303..463 CDD:398617 56/159 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346564
Domainoid 1 1.000 131 1.000 Domainoid score I5053
eggNOG 1 0.900 - - E1_KOG1183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247641at2759
OrthoFinder 1 1.000 - - FOG0005188
OrthoInspector 1 1.000 - - oto97676
orthoMCL 1 0.900 - - OOG6_103823
Panther 1 1.100 - - LDO PTHR21329
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3702
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.