DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-Q and pigq-1

DIOPT Version :9

Sequence 1:NP_001285323.1 Gene:PIG-Q / 117366 FlyBaseID:FBgn0086448 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_502086.2 Gene:pigq-1 / 178019 WormBaseID:WBGene00008504 Length:269 Species:Caenorhabditis elegans


Alignment Length:222 Identity:74/222 - (33%)
Similarity:112/222 - (50%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 RSRPANIVLDR--------ILGIILMLILFTLAT-----QPGDFLIQISHYVIDELYGLLKVLEG 267
            |:..|.|:|.|        :|.:...:.|:.:.|     ...:|..|..: |.|.|.|.:..|..
 Worm    12 RTLEAKILLVRTFSFTRLLLLDVAFSIYLWNIWTPNWEWTVNEFWDQTGN-VADNLNGTITWLRS 75

  Fly   268 SPIGLKLNIHLNNFFLDCFKYHIELWSTFLDFIEPLVRQVFLAIGMIGCLGFTFQIALLVDLISV 332
            :|.|||||..:|......|.|||.||:||:.|:.......|:|..:||.:. ||. |::.|...:
 Worm    76 NPAGLKLNTPVNETLAWFFTYHIYLWTTFIGFLRSDAFFRFIAYSLIGGIS-TFS-AMVYDFSQI 138

  Fly   333 IGLHSHCFYIYTKVLYNVERRGLSVLWQVVRGNRYNILKGRTESHNYMNRQLYLATIFFSAILFL 397
            ..||.:||..|...|..:....|:|||.:|||.::|.|:.|.::.....||.:|||..|..:||:
 Worm   139 FFLHFNCFDAYATKLCYLCYYTLTVLWSLVRGKKWNPLRERKDTVILDTRQQFLATSLFVILLFI 203

  Fly   398 LPTTLVYYIVFAALKALTFATLSVFHF 424
            |||..||::||..|:....|..:|.:|
 Worm   204 LPTIFVYFVVFRCLRLAVSALQTVLYF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-QNP_001285323.1 Gpi1 240..401 CDD:282831 58/165 (35%)
pigq-1NP_502086.2 Gpi1 24..207 CDD:282831 60/185 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162664
Domainoid 1 1.000 93 1.000 Domainoid score I4769
eggNOG 1 0.900 - - E1_KOG1183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247641at2759
OrthoFinder 1 1.000 - - FOG0005188
OrthoInspector 1 1.000 - - oto17323
orthoMCL 1 0.900 - - OOG6_103823
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R515
SonicParanoid 1 1.000 - - X3702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.640

Return to query results.
Submit another query.