DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-Q and Pigq

DIOPT Version :9

Sequence 1:NP_001285323.1 Gene:PIG-Q / 117366 FlyBaseID:FBgn0086448 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001277954.1 Gene:Pigq / 14755 MGIID:1333114 Length:641 Species:Mus musculus


Alignment Length:190 Identity:69/190 - (36%)
Similarity:113/190 - (59%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 VIDELYGLLKVLEGSPIGLKLNIHLNNFFLDCFKYHIELWSTFLDFIEPLVRQVFLAIGMIGCLG 318
            |.:||..||:.|.|:|.|||:|..|:......|.|||.||.:::..:.|.:..:...:|:..|||
Mouse   376 VAEELQHLLQWLMGAPAGLKMNRALDQVLGRFFLYHIHLWISYIHLMSPFIEHILWHVGLSACLG 440

  Fly   319 FTFQIALLVDLISVIGLHSHCFYIYTKVLYNVERRGLSVLWQVVRGNRYNILKGRTESHNYMNRQ 383
            .|..:::..|:|:::..|.:|||:|...||.::..|||.||::.||.::|:|:.|.:|.:|...|
Mouse   441 LTVALSIFSDIIALLTFHIYCFYVYGARLYCLKIYGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQ 505

  Fly   384 LYLATIFFSAILFLLPTTLVYYIVFAALKALTFATLSVFHFLRRKLMYLPIEVCIKRLLR 443
            |::.|:.|:.::||||||.:||:||..|:.|......:.|.|...:..||:.....||.|
Mouse   506 LFIGTLLFTILVFLLPTTALYYLVFTLLRLLVITVQGLIHLLVDLINSLPLYSLGLRLCR 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-QNP_001285323.1 Gpi1 240..401 CDD:282831 54/146 (37%)
PigqNP_001277954.1 Gpi1 373..523 CDD:368248 54/146 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843059
Domainoid 1 1.000 131 1.000 Domainoid score I5138
eggNOG 1 0.900 - - E1_KOG1183
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005188
OrthoInspector 1 1.000 - - oto94153
orthoMCL 1 0.900 - - OOG6_103823
Panther 1 1.100 - - LDO PTHR21329
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R515
SonicParanoid 1 1.000 - - X3702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.