DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PIG-Q and pigq

DIOPT Version :9

Sequence 1:NP_001285323.1 Gene:PIG-Q / 117366 FlyBaseID:FBgn0086448 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_001135518.1 Gene:pigq / 100216058 XenbaseID:XB-GENE-5867565 Length:563 Species:Xenopus tropicalis


Alignment Length:231 Identity:87/231 - (37%)
Similarity:137/231 - (59%) Gaps:2/231 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 KRSRPANIVLDRILGIILMLILF--TLATQPGDFLIQISHYVIDELYGLLKVLEGSPIGLKLNIH 277
            |.:...:|:||..|||:||..|:  ...:|..|.|:.::.:|..||.|||:.|.|:|.|||:|..
 Frog   257 KSNTVVSILLDMALGILLMSWLYRENRISQLADTLMPVADHVAVELQGLLQWLMGAPAGLKMNRA 321

  Fly   278 LNNFFLDCFKYHIELWSTFLDFIEPLVRQVFLAIGMIGCLGFTFQIALLVDLISVIGLHSHCFYI 342
            |:......|.|||.||.:::..:.|.:..:...||:..|||.:..:::|.|:|:::..|.:|||:
 Frog   322 LDEVLGRFFLYHIHLWISYIRLMSPFIEVILWYIGLSACLGLSVALSILSDIIALLTFHIYCFYV 386

  Fly   343 YTKVLYNVERRGLSVLWQVVRGNRYNILKGRTESHNYMNRQLYLATIFFSAILFLLPTTLVYYIV 407
            |...||..:..|||.||::.||.::|:|:.|.:|.:|...||:|.|:.|:.:|||||||.:||:|
 Frog   387 YGARLYCFKMHGLSSLWRLFRGKKWNVLRQRVDSCSYDLDQLFLGTLLFTILLFLLPTTALYYLV 451

  Fly   408 FAALKALTFATLSVFHFLRRKLMYLPIEVCIKRLLR 443
            |..|:.|......|.|.:...|..||:...:.||.|
 Frog   452 FTLLRLLVVLVQGVIHLIVDLLNTLPLYAMVLRLCR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PIG-QNP_001285323.1 Gpi1 240..401 CDD:282831 61/160 (38%)
pigqNP_001135518.1 Gpi1 259..431 CDD:282831 62/171 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 141 1.000 Domainoid score I4690
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247641at2759
OrthoFinder 1 1.000 - - FOG0005188
OrthoInspector 1 1.000 - - oto104362
Panther 1 1.100 - - LDO PTHR21329
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R515
SonicParanoid 1 1.000 - - X3702
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.140

Return to query results.
Submit another query.