DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HBS1 and eIF2gamma

DIOPT Version :9

Sequence 1:NP_001286906.1 Gene:HBS1 / 117365 FlyBaseID:FBgn0042712 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_001262587.1 Gene:eIF2gamma / 41843 FlyBaseID:FBgn0263740 Length:475 Species:Drosophila melanogaster


Alignment Length:294 Identity:67/294 - (22%)
Similarity:119/294 - (40%) Gaps:70/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 ERADQKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESK---KLG-KQSFMY---- 296
            |...:::.|::..||||..||||::..:     :..|.|..|:|.|..   ||| ..:.:|    
  Fly    33 EVISRQATINIGTIGHVAHGKSTVVKAI-----SGVQTVRFKNELERNITIKLGYANAKIYKCDN 92

  Fly   297 -------AWVLDETGEERARGITM--DVGQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADVA 352
                   ::|.|.:.::.:...|.  ..|..|:   .:.|:.:|.|||...:..|::||...|.|
  Fly    93 PKCPRPASFVSDASSKDDSLPCTRLNCSGNFRL---VRHVSFVDCPGHDILMATMLNGAAVMDAA 154

  Fly   353 LLVVDATRGEFESGFEL--GGQTREHAILVRSLGVNQLGVVINKLDTVGWSQ--DRFTEIVTKLK 413
            ||::        :|.|.  ..||.||...:..:.:.|:.::.||:|.:..||  :::.|| ||. 
  Fly   155 LLLI--------AGNESCPQPQTSEHLAAIEIMKLKQILILQNKIDLIKESQAKEQYEEI-TKF- 209

  Fly   414 SFLKLAGFKDSDVSFTPCSGLTGENLTKKAQEPALTNWYSGRHLLDVIENFKIPERAIDRPLRM- 477
                :.|.........|.|.....|:....:.              ::....:|.|..:.|.|: 
  Fly   210 ----VQGTVAEGAPIIPISAQLKYNIDVLCEY--------------IVNKIPVPPRDFNAPPRLI 256

  Fly   478 ------------SVSDIYKGTGSGFCISGRVETG 499
                        .|:|:..|...|..:||.::.|
  Fly   257 VIRSFDVNKPGCEVADLKGGVAGGSILSGVLKVG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HBS1NP_001286906.1 HBS1_N 83..145 CDD:286079
TEF1 241..669 CDD:227581 66/293 (23%)
EF1_alpha 249..468 CDD:206670 54/239 (23%)
HBS1-like_II 474..557 CDD:293912 9/39 (23%)
HBS1_C_III 561..669 CDD:294008
eIF2gammaNP_001262587.1 PTZ00327 11..465 CDD:240362 67/294 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464580
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.