DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HBS1 and CG33158

DIOPT Version :9

Sequence 1:NP_001286906.1 Gene:HBS1 / 117365 FlyBaseID:FBgn0042712 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_788515.1 Gene:CG33158 / 39834 FlyBaseID:FBgn0053158 Length:1033 Species:Drosophila melanogaster


Alignment Length:315 Identity:75/315 - (23%)
Similarity:115/315 - (36%) Gaps:110/315 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 PVVSGRNTPVDISAGDDISRSSATVFKVSKEQAVRNARQLYEKERADQKSHIHMIVIGHVDAGKS 261
            |||.|                |..|....:.|.|||                 :.::.|||.||:
  Fly     2 PVVEG----------------SDLVLLQRRRQQVRN-----------------ICILAHVDHGKT 33

  Fly   262 TLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETGEERARGITM---------DVGQ 317
            ||...|:...|.:|||:          .||..:     ||...:|:.|||||         ...:
  Fly    34 TLADSLVASNGIISQRM----------AGKLRY-----LDNRSDEQERGITMKSSSISLYYQEAE 83

  Fly   318 SRIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQTREHAILVRS 382
            ........::.|:|:|||.||...:.:.....|.|::|||...|       :|.|||   ..:|.
  Fly    84 EMAGNPDYLINLIDSPGHVDFSSEVSTAVRLCDGAIVVVDVVEG-------VGPQTR---ACLRQ 138

  Fly   383 LGVNQLG--VVINKLDTVGWSQ-----DRFTEIVTKLKSFLKLAG-FKDSDVSFTPCSGLTGENL 439
            :...||.  :|:||||.:...:     |.:..:...|:....:.| ...||:       |..|::
  Fly   139 IYEEQLKPVLVLNKLDRLILEKQMDPLDAYFHLCQVLEQVNAVLGSIFASDI-------LAKEDI 196

  Fly   440 TKKAQEPALTNWYSGRHLLDVIENFKIPERAIDRPLRMSVSDIYKGTGSG---FC 491
            |||                   :|::.....:|.      |::|....||   ||
  Fly   197 TKK-------------------DNYESALEEVDD------SELYFSPSSGNVIFC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HBS1NP_001286906.1 HBS1_N 83..145 CDD:286079
TEF1 241..669 CDD:227581 65/271 (24%)
EF1_alpha 249..468 CDD:206670 58/235 (25%)
HBS1-like_II 474..557 CDD:293912 6/21 (29%)
HBS1_C_III 561..669 CDD:294008
CG33158NP_788515.1 PTZ00416 15..1016 CDD:240409 69/286 (24%)
EF2 20..249 CDD:206672 67/281 (24%)
EF2_II 485..572 CDD:293913
EF2_snRNP_III 587..658 CDD:293918
aeEF2_snRNP_like_IV 658..899 CDD:238839
eEF2_snRNP_like_C 896..974 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.