DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HBS1 and eEF2

DIOPT Version :9

Sequence 1:NP_001286906.1 Gene:HBS1 / 117365 FlyBaseID:FBgn0042712 Length:670 Species:Drosophila melanogaster
Sequence 2:NP_525105.2 Gene:eEF2 / 35422 FlyBaseID:FBgn0000559 Length:844 Species:Drosophila melanogaster


Alignment Length:304 Identity:78/304 - (25%)
Similarity:111/304 - (36%) Gaps:94/304 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 DQKSHI-HMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDETGEE 306
            |:|.:| :|.||.|||.|||||...|:...|.::          ..|.|:..|     .|...:|
  Fly    14 DKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIA----------GAKAGETRF-----TDTRKDE 63

  Fly   307 RARGITM--------------DV------GQSRIETKTKIVTLLDAPGHKDFIPNMISGATQADV 351
            :.|.||:              |:      .|...|.|..::.|:|:|||.||...:.:.....|.
  Fly    64 QERCITIKSTAISMYFEVEEKDLVFITHPDQREKECKGFLINLIDSPGHVDFSSEVTAALRVTDG 128

  Fly   352 ALLVVDATRGEFESGFELGGQTR---EHAILVRSLGVNQLGVVINKLDTVGWS--------QDRF 405
            ||:|||...|       :..||.   ..||..|...:    :.:||:|.....        ...|
  Fly   129 ALVVVDCVSG-------VCVQTETVLRQAIAERIKPI----LFMNKMDRALLELQLDAEELYQTF 182

  Fly   406 TEIVTKLKSFLKLAGFKD-----SDVSFTPC-------SGLTGENLTKKAQEPALTNWYSGRHLL 458
            ..||..:.  :.:|.:.|     .:|...|.       |||.|...|.|    ..:..||.:..:
  Fly   183 QRIVENVN--VIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLK----QFSEMYSEKFKI 241

  Fly   459 DVI--------ENF---------KIPERAIDRPLRMSVSD-IYK 484
            ||:        |||         |..|....|...|.:.| |||
  Fly   242 DVVKLMNRLWGENFFNAKTKKWQKQKEADNKRSFCMYILDPIYK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HBS1NP_001286906.1 HBS1_N 83..145 CDD:286079
TEF1 241..669 CDD:227581 78/304 (26%)
EF1_alpha 249..468 CDD:206670 68/278 (24%)
HBS1-like_II 474..557 CDD:293912 5/12 (42%)
HBS1_C_III 561..669 CDD:294008
eEF2NP_525105.2 PTZ00416 1..844 CDD:240409 78/304 (26%)
EF2 20..236 CDD:206672 60/247 (24%)
EF2_snRNP_like_II 380..474 CDD:293901
EF2_snRNP_III 489..560 CDD:293918
aeEF2_snRNP_like_IV 560..732 CDD:238839
eEF2_snRNP_like_C 728..807 CDD:239763
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464666
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.