DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hex-t1 and YLR446W

DIOPT Version :9

Sequence 1:NP_788744.1 Gene:Hex-t1 / 117364 FlyBaseID:FBgn0042711 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_013551.1 Gene:YLR446W / 851167 SGDID:S000004438 Length:433 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:33/168 - (19%)
Similarity:71/168 - (42%) Gaps:31/168 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VFTFLATSIAN-FVKEKKVDKD--NLPLGIAFAFTL----KKLALDVGILVSWTKEFGAQGAIGK 173
            ::|......|| ::|:|....:  ...:.:.|:|.|    :.:|:..|.:::.|    .||:..|
Yeast   106 IYTICTRLAANGYIKKKNESSEASKFFVSVTFSFPLNPEGEVVAMGKGFVMTDT----LQGSTVK 166

  Fly   174 DVVQ-----LLRDALAKFPEISVDVMGIINVGAGSLLALCWAQPDTRIGLIMGSIANSCYVERVE 233
            .::|     ::.:.:.:| ..:::|..:||......|...:...:..|.||:|:..|:|:.....
Yeast   167 QLIQSSFHRIISENIEEF-FCTMNVCHVINDAIAVSLTSKFICENDSISLIIGTGTNACFEVPYG 230

  Fly   234 RCETYEGDEYR--------------KLMIINSDWAHFG 257
            ....::.|..|              |.::|||:....|
Yeast   231 YLPPFKRDALRETLPSSYNKETLNFKHVLINSEIGFIG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hex-t1NP_788744.1 COG5026 13..446 CDD:227359 33/168 (20%)
Hexokinase_1 13..209 CDD:278764 20/104 (19%)
Hexokinase_2 215..448 CDD:281689 13/57 (23%)
YLR446WNP_013551.1 COG5026 1..433 CDD:227359 33/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.