DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hex-t1 and HK2

DIOPT Version :9

Sequence 1:NP_788744.1 Gene:Hex-t1 / 117364 FlyBaseID:FBgn0042711 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_005264337.1 Gene:HK2 / 3099 HGNCID:4923 Length:938 Species:Homo sapiens


Alignment Length:481 Identity:151/481 - (31%)
Similarity:263/481 - (54%) Gaps:34/481 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FNPEEDFPEVYKVCK-LFNPSIDD--LEKIKNAMDREITMGLSRDHHDRSTVPCHLSYVQDLPTG 66
            |..|.:..:|.||.: |::..:.|  |.:|.....:|:..||....|..:.|....::|:..|.|
Human    10 FFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDG 74

  Fly    67 RERGQFLALEMMPTNCRIMLVKFSS--------ERDIYTSSKCVIMPHTVAAGRGTEVFTFLATS 123
            .|.|:||||::..||.|::.||.:.        |..||.      :|..:..|.||::|..:|..
Human    75 TEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYA------IPEDIMRGSGTQLFDHIAEC 133

  Fly   124 IANFVKEKKVDKDNLPLGIAFAFTLKKLALDVGILVSWTKEFGAQGAIGKDVVQLLRDALAKFPE 188
            :|||:.:.::....||||..|:|...:..||...||||||.|.:.|..|:|||.|:|.|:.:..:
Human   134 LANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGD 198

  Fly   189 ISVDVMGIINVGAGSLLALCWAQPDTRIGLIMGSIANSCYVERVERCETYEGDEYRKLMIINSDW 253
            ..:|::.::|...|:::...:...:..||||:|:.:|:||:|.:...:..||||.|  |.||.:|
Human   199 FDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDEGR--MCINMEW 261

  Fly   254 AHFGDTGQLDFIRNEYDRQLDTESINPGTRIYEKFSGALCMGELVRIIVLRLMKSGAIFAEDRRD 318
            ..|||.|.|:.||.|:|:::|..|:|||.:::||....:.||||||:|::::.|...:|......
Human   262 GAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSP 326

  Fly   319 YIGIQWKLDMVSLIEIVSDPPGVYTKAQEVMDKFRIRHCKERDLAALKYICDTVTNRAAMLVASG 383
            .:....:.:...:.:|..:..|: .||:||:.:..:...:| |..|...||..|:.|:|.|.|:.
Human   327 ELLNTGRFETKDISDIEGEKDGI-RKAREVLMRLGLDPTQE-DCVATHRICQIVSTRSASLCAAT 389

  Fly   384 VSCLIDRM-------RLPQISIAVDGGIYRLHPTFSTVLNKYTRLLADPNYNFEFVITQDSCGVG 441
            ::.::.|:       || :.:|.|||.:|:.||.|:..|:|..|.|. |..:..|:.::|..|.|
Human   390 LAAVLQRIKENKGEERL-RSTIGVDGSVYKKHPHFAKRLHKTVRRLV-PGCDVRFLRSEDGSGKG 452

  Fly   442 AAIMAGMAH--ANKYKTDAKLFTMDY 465
            ||::..:|:  |::::...|  |:::
Human   453 AAMVTAVAYRLADQHRARQK--TLEH 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hex-t1NP_788744.1 COG5026 13..446 CDD:227359 145/450 (32%)
Hexokinase_1 13..209 CDD:278764 64/206 (31%)
Hexokinase_2 215..448 CDD:281689 81/239 (34%)
HK2XP_005264337.1 PTZ00107 12..460 CDD:240270 146/459 (32%)
Hexokinase_1 21..219 CDD:278764 63/203 (31%)
Hexokinase_2 225..459 CDD:281689 81/239 (34%)
PTZ00107 462..929 CDD:240270 3/17 (18%)
Hexokinase_1 471..688 CDD:278764 2/8 (25%)
Hexokinase_2 694..928 CDD:281689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5026
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153545at2759
OrthoFinder 1 1.000 - - FOG0000301
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19443
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X170
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.