DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hex-t1 and AT1G47845

DIOPT Version :9

Sequence 1:NP_788744.1 Gene:Hex-t1 / 117364 FlyBaseID:FBgn0042711 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001321727.1 Gene:AT1G47845 / 28717337 AraportID:AT1G47845 Length:186 Species:Arabidopsis thaliana


Alignment Length:191 Identity:41/191 - (21%)
Similarity:81/191 - (42%) Gaps:55/191 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 YVERVERCETYEGDEYRKLMIINSDWAHFGDTGQLDFIRNEYDRQLDTESINPGTRIYEKFSGAL 292
            :.|.:.:.:..:...|..|||||::|..|...    ..:..:|:::|.||.|.|..:|||....:
plant    21 HYESMTKTDCIKRRHYIPLMIINTEWGGFSKV----LPQTIFDQEMDAESPNRGEHLYEKMVSGM 81

  Fly   293 CMGELVRIIVLRLMKSGAIFA-----------------------EDRRD---YIGIQWKLDMVSL 331
            .:||:||.::|::.::..:|.                       ||..|   .:|    |.:.::
plant    82 YLGEIVRRVLLQMCETSDLFGQFVPGGNLSKPFALKTEHLNKMQEDTTDDLQTVG----LVLYNI 142

  Fly   332 IEIVSDPPGVYTKAQEVMDKFRIRHCKERDLAALKYICDTVTNRAAMLVASGVSCLIDRMR 392
            :|:.::          :.::.|:..           :||||..|...|..:||:..|.::|
plant   143 LEVEAN----------LQERRRVVE-----------VCDTVVKRGGRLAGAGVNARIKQVR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hex-t1NP_788744.1 COG5026 13..446 CDD:227359 41/191 (21%)
Hexokinase_1 13..209 CDD:278764
Hexokinase_2 215..448 CDD:281689 41/191 (21%)
AT1G47845NP_001321727.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 128 1.000 Domainoid score I1730
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153545at2759
OrthoFinder 1 1.000 - - FOG0000301
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.