DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN2 and YML131W

DIOPT Version :9

Sequence 1:NP_001259986.1 Gene:FASN2 / 117361 FlyBaseID:FBgn0042627 Length:2410 Species:Drosophila melanogaster
Sequence 2:NP_013575.1 Gene:YML131W / 854908 SGDID:S000004600 Length:365 Species:Saccharomyces cerevisiae


Alignment Length:416 Identity:84/416 - (20%)
Similarity:146/416 - (35%) Gaps:105/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1391 GVP-QFSLDDPFYAAQL-AKDLVVNVYRNGSWGSYRHLKMESRPPMLPVEQAYVNTLVKGDLSSL 1453
            |.| .|...||....:| .|:|.....::|      .|.:|:             |.:..|.:..
Yeast    16 GEPFNFHFHDPACTFELIEKELSSEQLKDG------ELLLET-------------TYLSNDPAQK 61

  Fly  1454 RWIESPRSSPIQSQLEPCTVYYAPLNFRDVMLASGKLGVDALPGD------------LAYQDCVL 1506
            .||.|...:..:. ::|..:  .|......:|||......  |||            :..|:.|.
Yeast    62 FWISSMDKNYAKG-VQPGEI--IPARGIGKVLASRNKAFS--PGDYVSAVTGWTTHAIISQENVQ 121

  Fly  1507 GLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEVPSKWTMEQASTVPCVYATVYYALVVRGQ 1571
            ||....::..|:                     ||     |.:   |.:.....|.|:......|
Yeast   122 GLRKLDKNKVGK---------------------LW-----WYL---SVLGGTSLTAYFIFFTYAQ 157

  Fly  1572 MKE-----GERILIHAGSGGVGQAAISVAL--AHGLTVFTTVGSKEKREFLLKRFPKLKAKNIGN 1629
            ::|     |:..||...:|.||...|.:||  .....|....|..||..|:         ::.|:
Yeast   158 LQEREEDYGKVYLISGAAGAVGTVCIQLALNVFKASKVIAIAGGPEKVAFV---------ESFGD 213

  Fly  1630 S------RDTSFEQLIMSETHG-NGVELVLNSLSEEKLQASIRCLALNGRFLEIGKFDLSNNTP- 1686
            :      :|.||:|.::....| |.|:..::::....|:|.:..|......:..|.....|:.. 
Yeast   214 NVVGVDYKDPSFKQKLIEAAGGENTVDYFIDNVGSNVLEAGVLLLKQRAMLIACGAISAYNDPSK 278

  Fly  1687 ---LGMSVFL-KNTSFHGILLDSVMEGEEEMQLMVAKLVAEGIKSGAVQPLPTTVFAE------Q 1741
               .|.|..| |.....|:|   |.:..::....:.|| ...:|.|.:..|.:....:      :
Yeast   279 FVFKGYSFILTKRLVVKGVL---VTDNIDDFPKALDKL-GSLVKHGKIDLLKSATLEDGTGDKFK 339

  Fly  1742 EIEKAFRFMASGKHIGKVVIKVRLEE 1767
            .:...::.:.||.:.||::.||..||
Yeast   340 NVPLIWKGLFSGVNKGKLITKVNNEE 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN2NP_001259986.1 PksD 15..1043 CDD:225858
PKS 18..423 CDD:238429
KAsynt_C_assoc 381..498 CDD:292814
Acyl_transf_1 518..835 CDD:298668
hot_dog 875..1072 CDD:294345
NADB_Rossmann 1263..>1429 CDD:304358 10/39 (26%)
PKS_ER 1471..1761 CDD:214840 63/326 (19%)
enoyl_red 1473..1761 CDD:176179 63/324 (19%)
KR_1_FAS_SDR_x <1780..2018 CDD:187657
PKS_PP 2031..>2083 CDD:214834
Abhydrolase 2159..2408 CDD:304388
YML131WNP_013575.1 CurA 1..363 CDD:225041 82/412 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1925
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.