DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN2 and SPAPB24D3.08c

DIOPT Version :9

Sequence 1:NP_001259986.1 Gene:FASN2 / 117361 FlyBaseID:FBgn0042627 Length:2410 Species:Drosophila melanogaster
Sequence 2:NP_593994.1 Gene:SPAPB24D3.08c / 2543522 PomBaseID:SPAPB24D3.08c Length:349 Species:Schizosaccharomyces pombe


Alignment Length:422 Identity:96/422 - (22%)
Similarity:162/422 - (38%) Gaps:124/422 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1382 LRLYLILDEGVP-----------QFSLDDPFYAAQLAKD---LVVNVYRNGSWGSYRHLKMESRP 1432
            ::.||....|.|           :|.|::    ||:.::   |:.|:|.  |...|..::|:|  
pombe     9 IKKYLDSTAGYPVIGEHLAFEKREFDLEN----AQVDEETPVLLKNIYT--SVDPYLRMRMQS-- 65

  Fly  1433 PMLPVEQAYVNTLVKGDLSSLRWIESPRSSPIQSQLEPCTVYYAPLNFRDVMLASGKLGVDALPG 1497
               |...:|:..|..|.    .:..|..:..::|.|:    .|.|  ..||:..||         
pombe    66 ---PKHASYIPPLELGK----PFYNSTVAKVVKSTLD----QYKP--GMDVVFVSG--------- 108

  Fly  1498 DLAYQDCVLGLEFAGRDSCGRRVMAMVTAKSLATNCLANRNLLWEVPSKWTMEQASTVPCVYATV 1562
               :::    ..|..:.:.|               .|...|..:::|   .::...::.....|.
pombe   109 ---WEE----YTFVSKQALG---------------FLQPINNPYKLP---LIDFVGSLGMPSQTA 148

  Fly  1563 YYALVVRGQMKEGERILIHAGSGGVGQAAISVALAHGLTVFTTVGSKE----------------K 1611
            |..|...|:.|.||.|.|.|.||.|||.|..:|.|.||.|..:|||.|                |
pombe   149 YCGLKHIGKPKAGETIYISAASGAVGQMAGQLAKAMGLHVVGSVGSDEKFKICLDSGYDSVFNYK 213

  Fly  1612 REFLLKRFPKLKAKNIGNSRDTSFEQLIMSETHGNGVELVLNSLSEEKLQASIRCLALNGRFLEI 1676
            :|...|..|:|..|                     |:::...::..|.:.|.:..:.|.||.:..
pombe   214 KESPFKALPRLCPK---------------------GIDIYFENVGGETMDAVLENMNLQGRIIFC 257

  Fly  1677 GKFDLSNN-TP-----LGMSVFLKNTSFHGILLDSVM-EGEEEMQLMVAKLVAEG---IKSGAVQ 1731
            |.....|| .|     ||| |.:|:.:..|.::.::: :.:|:....:.||:|||   .|.....
pombe   258 GAISQYNNPNPYRVKNLGM-VLVKSLTIQGFIVANILPQYQEQYFEEMPKLIAEGKIKYKCDVYD 321

  Fly  1732 PLPTTVFAEQEIEKAFRFMASGKHIGKVVIKV 1763
            .|       :...:||..|..||:.||.::|:
pombe   322 GL-------ESAPEAFIGMLQGKNSGKTIVKI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN2NP_001259986.1 PksD 15..1043 CDD:225858
PKS 18..423 CDD:238429
KAsynt_C_assoc 381..498 CDD:292814
Acyl_transf_1 518..835 CDD:298668
hot_dog 875..1072 CDD:294345
NADB_Rossmann 1263..>1429 CDD:304358 13/60 (22%)
PKS_ER 1471..1761 CDD:214840 73/315 (23%)
enoyl_red 1473..1761 CDD:176179 73/313 (23%)
KR_1_FAS_SDR_x <1780..2018 CDD:187657
PKS_PP 2031..>2083 CDD:214834
Abhydrolase 2159..2408 CDD:304388
SPAPB24D3.08cNP_593994.1 CurA 1..348 CDD:225041 96/422 (23%)
PGDH 3..344 CDD:176190 95/418 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1925
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.