DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FASN2 and F32H2.6

DIOPT Version :9

Sequence 1:NP_001259986.1 Gene:FASN2 / 117361 FlyBaseID:FBgn0042627 Length:2410 Species:Drosophila melanogaster
Sequence 2:NP_492421.1 Gene:F32H2.6 / 185214 WormBaseID:WBGene00009343 Length:187 Species:Caenorhabditis elegans


Alignment Length:166 Identity:64/166 - (38%)
Similarity:89/166 - (53%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DIVISGLSGKLPESSN--IEEFKYNLLNGIDMVTDEPRRWEAGIYGLPERMAKMKDSDLEKFDDK 80
            |||||  ..::|...|  ::.|...||...|:||::...|..|...||::..|.|  ||.|||..
 Worm    12 DIVIS--KDQIPRCDNKEVKMFGGMLLACDDVVTEDQLSWAPGFTDLPKKRGKKK--DLNKFDAG 72

  Fly    81 FFSVHQKQAELMDPCMRMLLELTHEAIIDAGINPVQLRGSRTGVY-----IGLSFVETEHEIPNM 140
            ......||...|||.:|:|||.:.||::||||||..||||:.|.:     .|.|..:.::.:..|
 Worm    73 ILPGTSKQNNPMDPQVRLLLEASWEAMVDAGINPRGLRGSQIGDFDECATPGTSGTQKQNPVTEM 137

  Fly   141 EPSSINGYCLTGCARAMFANRISYTFDFKGPSFIVD 176
                  |..::....:||:||||||||.:|||...|
 Worm   138 ------GCIMSDTVPSMFSNRISYTFDLQGPSHSAD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FASN2NP_001259986.1 PksD 15..1043 CDD:225858 64/166 (39%)
PKS 18..423 CDD:238429 64/166 (39%)
KAsynt_C_assoc 381..498 CDD:292814
Acyl_transf_1 518..835 CDD:298668
hot_dog 875..1072 CDD:294345
NADB_Rossmann 1263..>1429 CDD:304358
PKS_ER 1471..1761 CDD:214840
enoyl_red 1473..1761 CDD:176179
KR_1_FAS_SDR_x <1780..2018 CDD:187657
PKS_PP 2031..>2083 CDD:214834
Abhydrolase 2159..2408 CDD:304388
F32H2.6NP_492421.1 ketoacyl-synt <58..>167 CDD:365879 46/116 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3321
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4124
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19161at2759
OrthoFinder 1 1.000 - - FOG0001625
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.