DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and PCYT1B

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_004836.2 Gene:PCYT1B / 9468 HGNCID:8755 Length:369 Species:Homo sapiens


Alignment Length:288 Identity:160/288 - (55%)
Similarity:206/288 - (71%) Gaps:16/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 TICKPAPYSHDEEAMLERDRCDYTQRITYQMARSG-QTTRRVRVYADGIYDLFHQGHARQLMQAK 229
            |:..|||::.:.....:...    :::|...||.| ...|.||||||||:||||.||||.|||||
Human    40 TLTAPAPFADETNCQCQAPH----EKLTIAQARLGTPADRPVRVYADGIFDLFHSGHARALMQAK 100

  Fly   230 NIFPNVYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCRYVDEIVQNAPWTLSDEFIADNKIDF 294
            .:|||.||:||||:|:|||:.||.||||..||||.:||||||||::::|||||:.||:..:||||
Human   101 TLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCRYVDEVIRDAPWTLTPEFLEKHKIDF 165

  Fly   295 VAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSDIVARIVKDYDLYVRRNLARGYSAKEL 359
            ||||||||.:.|.||:|..:|..||||.|:||||:|||||:.|||:|||:|.||||.|||:||||
Human   166 VAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIVRDYDVYARRNLQRGYTAKEL 230

  Fly   360 NVSFLSEKKFRLQNKMDELKSRGK--RELSKVKV--------DIITKWEEKSREFIDTFLLLFGR 414
            ||||::||::|.||::|::|.:.|  .|.||..|        |:|.||||||||||..||.|||.
Human   231 NVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEEKSREFIGNFLELFGP 295

  Fly   415 ENL-NHLWNESKGKLLQALSPPGSPSGS 441
            :.. ..::.|...::||||||..||..|
Human   296 DGAWKQMFQERSSRMLQALSPKQSPVSS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 152/251 (61%)
CCT 204..353 CDD:173925 102/148 (69%)
PCYT1BNP_004836.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
PLN02413 72..314 CDD:215229 145/241 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 309..369 9/15 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146327
Domainoid 1 1.000 204 1.000 Domainoid score I2954
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 332 1.000 Inparanoid score I2430
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172502at2759
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - mtm8588
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - O PTHR10739
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R892
SonicParanoid 1 1.000 - - X834
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.