DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and ECT1

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_011521.1 Gene:ECT1 / 852890 SGDID:S000003239 Length:323 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:79/267 - (29%)
Similarity:123/267 - (46%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 RVYADGIYDLFHQGHARQLMQAKNIF--PNVYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHCR 269
            :|:.||.:|..|.|||..::||:...  .|..|..||..||.....||..|||..||||..|..|
Yeast     9 KVWIDGCFDFTHHGHAGAILQARRTVSKENGKLFCGVHTDEDIQHNKGTPVMNSSERYEHTRSNR 73

  Fly   270 YVDEIVQNAPWTLSDEFIADNKIDFVAH-DDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSD 333
            :..|:|:.||:.....::...:..:|.| |||....:| :|.|..:|..|.|...:||.||||::
Yeast    74 WCSEVVEAAPYVTDPNWMDKYQCQYVVHGDDITIDANG-EDCYKLVKEMGRFKVVKRTYGVSTTE 137

  Fly   334 IVARIVKDYDLYVRRNLA---RGYSAKELNVSFLSEKKFRLQNKMDELKSRGKRELSKVKVDIIT 395
            |:.||:      .:::|.   ..|......:||.|.    .|:.:.:.....:|:|..|.|:...
Yeast   138 IIHRIL------TKKSLPPTHPDYYPTTQELSFYSV----AQDAVSKHCYVFQRDLDNVLVNGGY 192

  Fly   396 KWEEKSREFIDTFLLLFGRENLNHLWNESKGKLLQALSPPGSPSGSVNGDDTEGGEDYSETIDEY 460
            |::.:...::|....||...:::.|     .||...|.|   ....:.|..|   .|||.||   
Yeast   193 KFDAEDCVYVDGDFDLFHMGDIDQL-----RKLKMDLHP---DKKLIVGITT---SDYSSTI--- 243

  Fly   461 LEMAEKL 467
            :.|.|::
Yeast   244 MTMKERV 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 77/260 (30%)
CCT 204..353 CDD:173925 52/151 (34%)
ECT1NP_011521.1 CCT 6..157 CDD:173925 53/154 (34%)
PTZ00308 9..321 CDD:140329 79/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.