DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and CCT2

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_193249.5 Gene:CCT2 / 827179 AraportID:AT4G15130 Length:304 Species:Arabidopsis thaliana


Alignment Length:293 Identity:123/293 - (41%)
Similarity:179/293 - (61%) Gaps:34/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPNVYLIVGVCNDELTHRMKGRTVMNGFERYE 263
            |..:.|.||||||||:||||.||||.:.|||..|||.||:||.||||:|::.||:|||...||||
plant    14 SSSSDRPVRVYADGIFDLFHFGHARAIEQAKKSFPNTYLLVGCCNDEITNKFKGKTVMTESERYE 78

  Fly   264 GVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYV-TDGM-DDIYAPLKARGMFVATERT 326
            .:|||::|||::.:|||.|:.||:..:|||:||||.:||. |.|. :|:|..:|:.|.|..|:||
plant    79 SLRHCKWVDEVIPDAPWVLTTEFLDKHKIDYVAHDALPYADTSGAGNDVYEFVKSIGKFKETKRT 143

  Fly   327 EGVSTSDIVARIVKDYDLYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKSRGKRELSKVKV 391
            ||:|||||:.||||||:.||.|||.||||.:||.||| .||:.|:..::.:|:.:.|.:..|::.
plant   144 EGISTSDIIMRIVKDYNQYVLRNLDRGYSREELGVSF-EEKRLRVNMRLKKLQEKVKEQQEKIQT 207

  Fly   392 DIIT------KWEEKSREFIDTFLLLFG--------------RENLNHLWNESKGKLLQALSPPG 436
            ...|      :|.|.:..::..||.:|.              ::.|....:|...:|||      
plant   208 VAKTAGMHHDEWLENADRWVAGFLEMFEEGCHKMGTAIRDGIQQRLMRQESEENRRLLQ------ 266

  Fly   437 SPSG---SVNGDDTEGGEDYSETIDEYLEMAEK 466
              :|   |.:.||.:..:|.....::.:.::.|
plant   267 --NGLTISKDNDDEQMSDDNEFAEEDCVNVSNK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 121/284 (43%)
CCT 204..353 CDD:173925 90/150 (60%)
CCT2NP_193249.5 PLN02413 19..282 CDD:215229 120/271 (44%)
CCT 19..170 CDD:173925 90/150 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 174 1.000 Domainoid score I1110
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I1093
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172502at2759
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - mtm1135
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - O PTHR10739
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X834
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.920

Return to query results.
Submit another query.