DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and CCT1

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_180785.1 Gene:CCT1 / 817786 AraportID:AT2G32260 Length:332 Species:Arabidopsis thaliana


Alignment Length:273 Identity:123/273 - (45%)
Similarity:169/273 - (61%) Gaps:13/273 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFP-NVYLIVGVCNDELTHRMKGRTVMNGFERY 262
            |..|.|.|||||||||||||.||||.|.|||..|| |.||:||.||||.||:.||||||...|||
plant    28 SPPTDRPVRVYADGIYDLFHFGHARSLEQAKLAFPNNTYLLVGCCNDETTHKYKGRTVMTAEERY 92

  Fly   263 EGVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYV--TDGMDDIYAPLKARGMFVATER 325
            |.:|||::|||::.:|||.::.||:..::||:||||.:||.  :....|:|..:|..|.|..|:|
plant    93 ESLRHCKWVDEVIPDAPWVVNQEFLDKHQIDYVAHDSLPYADSSGAGKDVYEFVKKVGRFKETQR 157

  Fly   326 TEGVSTSDIVARIVKDYDLYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKSRGKRELSKVK 390
            |||:|||||:.||||||:.||.|||.||||.::|.|||:.||:.|:..::.:|:.|.|.:..:|.
plant   158 TEGISTSDIIMRIVKDYNQYVMRNLDRGYSREDLGVSFVKEKRLRVNMRLKKLQERVKEQQERVG 222

  Fly   391 VDIIT------KWEEKSREFIDTFLLLFGRENLNHLWNESKGKLLQALSPPGSPSGSVNGDDTEG 449
            ..|.|      :|.|.:..::..||.:| .|..:.:.......:.:.|....|.....||.|.:.
plant   223 EKIQTVKMLRNEWVENADRWVAGFLEIF-EEGCHKMGTAIVDSIQERLMRQKSAERLENGQDDDT 286

  Fly   450 GEDYSETIDEYLE 462
            .:.:.|   ||.:
plant   287 DDQFYE---EYFD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 122/268 (46%)
CCT 204..353 CDD:173925 90/151 (60%)
CCT1NP_180785.1 PLN02413 26..293 CDD:215229 121/268 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 174 1.000 Domainoid score I1110
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 238 1.000 Inparanoid score I1093
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1172502at2759
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - mtm1135
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - O PTHR10739
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X834
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.920

Return to query results.
Submit another query.