DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and Pcyt2

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_077191.2 Gene:Pcyt2 / 68671 MGIID:1915921 Length:404 Species:Mus musculus


Alignment Length:269 Identity:73/269 - (27%)
Similarity:118/269 - (43%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RRVRVYADGIYDLFHQGHARQLMQAKNIFPNVYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHC 268
            |.|||:.||.||:.|.||:.||.||:.:  ..||||||..||...:.||..|....|||:.|:..
Mouse    21 RIVRVWCDGCYDMVHYGHSNQLRQARAM--GDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAI 83

  Fly   269 RYVDEIVQNAPWTLSDEFIADNKIDFVAH-DDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTS 332
            ::|||:|..||:..:.|.:..:..||..| :||....||. |.|..:|..|.:...:||:||||:
Mouse    84 KWVDEVVPAAPYVTTLETLDKHNCDFCVHGNDITLTVDGR-DTYEEVKQAGRYRECKRTQGVSTT 147

  Fly   333 DIVARIVKDYDLYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKSRGKRELSKVKVDIITKW 397
            |:|.|::    |..:.:    :|::|::..:                                  
Mouse   148 DLVGRML----LVTKAH----HSSQEMSSEY---------------------------------- 170

  Fly   398 EEKSREFIDTFLLLFGRENLNHLWNESKGKLLQALSPPGSPSGSVNGDDTE----GGEDYSETID 458
                ||:.|:|                 ||     .|..:|:|.....:..    ||:.....:.
Mouse   171 ----REYADSF-----------------GK-----PPHPTPAGDTLSSEVSSQCPGGQSPWTGVS 209

  Fly   459 EYLEMAEKL 467
            ::|:.::|:
Mouse   210 QFLQTSQKI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 71/262 (27%)
CCT 204..353 CDD:173925 58/149 (39%)
Pcyt2NP_077191.2 PTZ00308 15..390 CDD:140329 73/269 (27%)
CCT 21..163 CDD:173925 58/152 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..201 7/49 (14%)
ECT 230..382 CDD:173924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.