DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and PCYT2

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001171846.1 Gene:PCYT2 / 5833 HGNCID:8756 Length:407 Species:Homo sapiens


Alignment Length:270 Identity:74/270 - (27%)
Similarity:118/270 - (43%) Gaps:78/270 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RRVRVYADGIYDLFHQGHARQLMQAKNIFPNVYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHC 268
            |.|||:.||.||:.|.||:.||.||:.:  ..||||||..||...:.||..|....|||:.|:..
Human    21 RAVRVWCDGCYDMVHYGHSNQLRQARAM--GDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAI 83

  Fly   269 RYVDEIVQNAPWTLSDEFIADNKIDFVAH-DDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTS 332
            ::|||:|..||:..:.|.:.....||..| :||....||. |.|..:|..|.:...:||:||||:
Human    84 KWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGR-DTYEEVKQAGRYRECKRTQGVSTT 147

  Fly   333 DIVARIVKDYDLYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKSRGKRELSKVKVDIITKW 397
            |:|.|::    |..:.:    :|::|::..:                                  
Human   148 DLVGRML----LVTKAH----HSSQEMSSEY---------------------------------- 170

  Fly   398 EEKSREFIDTFLLLFGRENLNHLWNESKGKLLQALSPPGS-PSGSVNGDD----TEGGEDYSETI 457
                ||:.|:|                 ||      ||.. |:|.:...:    ..||.:....:
Human   171 ----REYADSF-----------------GK------PPHPIPAGDILSSEGCSQCPGGRNPWTGV 208

  Fly   458 DEYLEMAEKL 467
            .::|:.::|:
Human   209 SQFLQTSQKI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 72/263 (27%)
CCT 204..353 CDD:173925 58/149 (39%)
PCYT2NP_001171846.1 PLN02406 14..390 CDD:333446 74/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.