DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and Pect

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_723789.2 Gene:Pect / 34716 FlyBaseID:FBgn0032482 Length:393 Species:Drosophila melanogaster


Alignment Length:173 Identity:64/173 - (36%)
Similarity:92/173 - (53%) Gaps:12/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 SGQTTRRVRVYADGIYDLFHQGHARQLMQAKNIFPNVYLIVGVCNDELTHRMKGRTVMNGFERYE 263
            |.:..:.|||:.||.||:.|.|||..|.|||.:...|  |||:..||...:.||..|....||.:
  Fly    14 SDKQRKDVRVWCDGCYDMVHFGHANSLRQAKALGDKV--IVGIHTDEEITKHKGPPVFTEEERVK 76

  Fly   264 GVRHCRYVDEIVQNAPWTLSDEFIADNKIDFVAH-DDIPYVTDGMDDIYAPLKARGMFVATERTE 327
            .|:..::|||:|..||:..:.:.:..|..||..| |||....:|: |.|..:|:...:...:||.
  Fly    77 MVKGIKWVDEVVLGAPYVTTLDVLDQNNCDFCVHGDDITMTAEGV-DTYHLVKSANRYKEVKRTA 140

  Fly   328 GVSTSDIVARIVKDYDLYVRRNLARGYSAK---ELNVSFLSEK 367
            ||||:|:|.|:     |.:.||..|..||:   |..||.|..:
  Fly   141 GVSTTDLVGRM-----LLLTRNHFRQGSAEYDIEKEVSILKRQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 63/170 (37%)
CCT 204..353 CDD:173925 56/149 (38%)
PectNP_723789.2 PTZ00308 16..381 CDD:140329 63/171 (37%)
CCT 19..165 CDD:173925 58/153 (38%)
ECT 223..373 CDD:173924
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447745
Domainoid 1 1.000 54 1.000 Domainoid score I645
eggNOG 1 0.900 - - E1_COG0615
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.