DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcyt1 and SPCC1827.02c

DIOPT Version :9

Sequence 1:NP_001261264.1 Gene:Pcyt1 / 117353 FlyBaseID:FBgn0041342 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_588548.2 Gene:SPCC1827.02c / 2539176 PomBaseID:SPCC1827.02c Length:362 Species:Schizosaccharomyces pombe


Alignment Length:291 Identity:125/291 - (42%)
Similarity:168/291 - (57%) Gaps:55/291 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RRVRVYADGIYDLFHQGHARQLMQAKNIFPNVYLIVGVCNDELTHRMKGRTVMNGFERYEGVRHC 268
            |.|||||||::||||.||.|||.|||.:||||:||||:.||:||||:||.||||..||.|.:|||
pombe   100 RPVRVYADGVFDLFHIGHMRQLEQAKKVFPNVHLIVGLPNDQLTHRLKGLTVMNDKERAEALRHC 164

  Fly   269 RYVDEIVQNAPWTLSDEFIADNKIDFVAHDDIPYVTDGMDDIYAPLKARGMFVATERTEGVSTSD 333
            ::|||:::||||.::.||:.::||||||||||||.:|...|||.|:|..|.|:.|:|||||||||
pombe   165 KWVDEVLENAPWVITPEFLEEHKIDFVAHDDIPYASDDSGDIYLPVKKVGKFIPTKRTEGVSTSD 229

  Fly   334 IVARIVKDYDLYVRRNLARGYSAKELNVSFLSEKKFRLQNKMDELKSRGKRELSKVKVDIITKWE 398
            ::.||::|||.||.||||||.:.||||||...:.:..|::.:..|:.           .:...|.
pombe   230 LITRIIRDYDQYVMRNLARGVNRKELNVSLFKKNELDLRHHIKVLRD-----------TLRNHWV 283

  Fly   399 EKSREF---IDTFLLLFGRENLNHLWNESKGKLLQALSPPGSPSGSVNGDDTEGGEDYSETIDEY 460
            ..:|:.   |.:||.:...:      .:.:...|...|.|.||                      
pombe   284 STTRDLKADIKSFLSMATTD------YQLQKNPLHGSSEPSSP---------------------- 320

  Fly   461 LEMAEKLSGGSGSGSSGSLNGKQRPKQKRSS 491
                         |.:|.|.|..|..|:|||
pombe   321 -------------GPTGFLGGINRWMQRRSS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pcyt1NP_001261264.1 PLN02413 202..462 CDD:215229 116/260 (45%)
CCT 204..353 CDD:173925 96/148 (65%)
SPCC1827.02cNP_588548.2 CCT 100..249 CDD:173925 96/148 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 186 1.000 Domainoid score I764
eggNOG 1 0.900 - - E1_COG0615
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001344
OrthoInspector 1 1.000 - - otm47191
orthoMCL 1 0.900 - - OOG6_101770
Panther 1 1.100 - - O PTHR10739
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R892
SonicParanoid 1 1.000 - - X834
TreeFam 1 0.960 - -
1110.800

Return to query results.
Submit another query.