DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr98d

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_733214.1 Gene:Gr98d / 43309 FlyBaseID:FBgn0046885 Length:412 Species:Drosophila melanogaster


Alignment Length:400 Identity:85/400 - (21%)
Similarity:158/400 - (39%) Gaps:86/400 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLGLFP----FTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAM----SSHLASKQR--RKYNAFER 82
            :.||.|    ||    |...||.|.:::.|:..:.:::.|.:    .:::.:.|:  .|::|.:.
  Fly    21 IFGLTPPIQFFT----RTLHKRRRGIVILGYACYLISISLMVIYECYANIVALQKDIHKFHAEDS 81

  Fly    83 NPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFNCFVIK 147
            :.::........|..|....:.:|:|.   ..:.:|.:::..||      :.|.|..  :.||.:
  Fly    82 SKVMGNTQKVLVVAMFVWNQLNILLNF---RRLARIYDDIADLE------IDLNNAS--SGFVGQ 135

  Fly   148 KH--------VAAIGQFVISIY-----FCLCQENSYPK-ILKILCCLPSVGLQLIIMHFHTEIIL 198
            :|        ..::|.:::.:.     |.|.....|.. ..|:|..:..:.|||....:...::|
  Fly   136 RHWWRFRFRLALSVGLWIVLLVGLTPRFTLVALGPYLHWTNKVLTEIILIMLQLKCTEYCVFVLL 200

  Fly   199 VYRYVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVVACNDLQLILMLIIYLIGNTVQIFF 263
            :|..:      |...|.|....:. |.....| ..:.||.||....||:...|..|: |.|.::|
  Fly   201 IYELI------LRGRHILQQISVE-LEGNQSR-DSVQELCVALKRNQLLAGRIWGLV-NEVSLYF 256

  Fly   264 LIVLGVSMNKRYIYLVASPQLIINFWDFW------------------------LNIVVCDLAGKC 304
            .:    |:...::|...:...|:|    |                        :||.:..|..:.
  Fly   257 TL----SLTLLFLYNELTILQIVN----WALIKSVNPNECCQYRRVGTCLLLSINIFLSCLYSEF 313

  Fly   305 GDQT----SKVLKLFTDLEHDDEE--LERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITS 363
            ..||    |:||.....|...::.  |:..|.|::....|.|..|...|||.||......|::|.
  Fly   314 CIQTYNSISRVLHQMYCLSAAEDYLILKMGLREYSLQMEHLKLIFTCGGLFDINLKFFGGMVVTL 378

  Fly   364 FLYLVYLLQF 373
            |.|::.|:||
  Fly   379 FGYIIILVQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 84/399 (21%)
Gr98dNP_733214.1 7tm_7 13..392 CDD:285581 84/399 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.