DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr98a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_651564.1 Gene:Gr98a / 43305 FlyBaseID:FBgn0039520 Length:391 Species:Drosophila melanogaster


Alignment Length:395 Identity:76/395 - (19%)
Similarity:155/395 - (39%) Gaps:80/395 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMC---LAMSSHLASKQRRKYN-AFERN 83
            |:|:.||.:         ::|.:...:|.:|..|.|...|   |.:|...:|..|..:: .|:.:
  Fly     8 LHAASLLYM---------RRLMKCLGMLPFGQNLFSKGFCYVLLFVSLGFSSYWRFSFDYEFDYD 63

  Fly    84 PLLEKIYMQFQVTTFFTI----SVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPN---- 140
            .|.::......::.|..:    ::::|..:| .|..:.:..:|..:..|:|..|...|..:    
  Fly    64 FLNDRFSSTIDLSNFVALVLGHAIIVLELLW-GNCSKDVDRQLQAIHSQIKLQLGTSNSTDRVRR 127

  Fly   141 -----FNCFVIKKHVAAIGQFVISIYF--CLCQENSYPKILKI-------LCCLPSVGLQLIIMH 191
                 :...:|:..:.    .|::||.  .|....:|.:::.:       |.|       .:|:.
  Fly   128 YCNWIYGSLIIRWLIF----IVVTIYSNRALTINATYSELVFLARFSEFTLYC-------AVILF 181

  Fly   192 FHTEIIL--------VYR---YVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVVACNDLQ 245
            .:.|:|:        :||   .:|.:       ..||..::..|.::::.|.:....:.....|.
  Fly   182 IYQELIVGGSNVLDELYRTRYEMWSI-------RRLSLQKLAKLQAIHNSLWQAIRCLECYFQLS 239

  Fly   246 LILMLIIYLIGNTVQIFFLIVLGVSMNK----RYIYLVASPQLIINFWDFWLNIVV-CDLAGKCG 305
            ||.:|:.:.|..:...::|.:..|...:    .|:..|...:|        |.||| |.|..:|.
  Fly   240 LITLLMKFFIDTSALPYWLYLSRVEHTRVAVQHYVATVECIKL--------LEIVVPCYLCTRCD 296

  Fly   306 DQTSKVLKLFTDLEHD--DEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLV 368
            ....|.|.:|..:..|  ..:|..:|.......:..|::|...|:..||..|..:.......|:|
  Fly   297 AMQRKFLSMFYTVTTDRRSSQLNAALRSLNLQLSQEKYKFSAGGMVDINTEMLGKFFFGMISYIV 361

  Fly   369 YLLQF 373
            ..:||
  Fly   362 ICIQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 76/395 (19%)
Gr98aNP_651564.1 7tm_7 13..370 CDD:285581 74/390 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.