DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr59e

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_788431.1 Gene:Gr59e / 37725 FlyBaseID:FBgn0041233 Length:399 Species:Drosophila melanogaster


Alignment Length:442 Identity:88/442 - (19%)
Similarity:157/442 - (35%) Gaps:153/442 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 WFMLQTTLYASWLLGLFPFTFDSRRKQLKR------SRWLLLYGFVLHSLAMCLAMSSHLASKQR 74
            |..|..|:  :..||::|    |.|..:.|      |.:||:|.:. .|:..||..:..:     
  Fly     6 WENLLLTI--NRFLGVYP----SGRVGVLRWLHTLWSLFLLMYIWT-GSIVKCLEFTVEI----- 58

  Fly    75 RKYNAFERNPLLEK-IYMQFQVTTFFTISVLLLMNVWKSNTVRKIAN-------ELLT-LEGQVK 130
                     |.:|| :|:........||::|:...|..    |.:|:       .::| |:|:.|
  Fly    59 ---------PTIEKLLYLMEFPGNMATIAILVYYAVLN----RPLAHGAELQIERIITGLKGKAK 110

  Fly   131 DLLTLKNCPNFNCFVIKKHVAAIGQFVIS------IYFCLC----------------QENSYPKI 173
            .|            |.|:|    ||..:.      ::..||                ..||    
  Fly   111 RL------------VYKRH----GQRTLHLMATTLVFHGLCVLVDVVNYDFEFWTTWSSNS---- 155

  Fly   174 LKILCCLPSVGLQLIIMHFHTEIILVYRYVWLVNETL--------------EDSHHLSSSRIHAL 224
               :..||.:.:.|.::.:...:    .::|||.:.:              :.|..|.:....|.
  Fly   156 ---VYNLPGLMMSLGVLQYAQPV----HFLWLVMDQMRMCLKELKLLQRPPQGSTKLDACYESAF 213

  Fly   225 ASLYD----RLLKLSELVVACNDL-----QLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVA 280
            |.|.|    ..|.:.|:...||.:     |.:|...:||:.|.:.  .|:.:.|.:         
  Fly   214 AVLVDAGGGSALMIEEMRYTCNLIEQVHSQFLLRFGLYLVLNLLN--SLVSICVEL--------- 267

  Fly   281 SPQLIINF-----WD---------FWLNI------VVCDLAGKCGDQTSKVLKLFTDLEHDDEEL 325
              .||.||     |:         .||.:      .:..:..:..:|...:.:|..:||.....|
  Fly   268 --YLIFNFFETPLWEESVLLVYRLLWLAMHGGRIWFILSVNEQILEQKCNLCQLLNELEVCSSRL 330

  Fly   326 ERSLNEFAWLCTHRKF--RFQLCGLFSINHN-----MGFQMIITSFLYLVYL 370
            :|::|.|. |...|..  ..:.||:.:::..     :|..|.|..||..:.|
  Fly   331 QRTINRFL-LQLQRSIDQPLEACGIVTLDTRSLGGFIGVLMAIVIFLIQIGL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 87/439 (20%)
Gr59eNP_788431.1 7tm_7 9..381 CDD:285581 86/437 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.