DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr57a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:457 Identity:90/457 - (19%)
Similarity:157/457 - (34%) Gaps:160/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLA----- 64
            :|...|.|.....:||      :|:|...|       .::||.:.:.:...::|:::.:|     
  Fly     9 EPETVFDCAAFICILQ------FLMGCNGF-------GIRRSTFRISWASRIYSMSVAIAAFCCL 60

  Fly    65 ---MSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTF-FTISVLLLMNVWKSNTVRKIANELLTL 125
               :|..||.:..|:..|...|.:|....::..::|. |.::|:.|....:.:.  .|...|..|
  Fly    61 FGSLSVLLAEEDIRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHL--GIYQRLAAL 123

  Fly   126 EGQVKDLLTLKNCPNFNC-FVIKKHVAAIGQFVISIY---------------------FCLCQ-- 166
            :.:    |......|.|. .:::|::|.:| .|.:||                     |.||.  
  Fly   124 DAR----LMSDFGANLNYRKMLRKNIAVLG-IVTTIYLMAINSAAVQVASGHRALFLLFALCYTI 183

  Fly   167 -----------ENSYPKILKILCCLPSVGLQLIIMHF-----HTEIILVYRYVWLVNETLEDSHH 215
                       ..:..::|.|...|....||...:::     |.:.:.:.:.|.::.|       
  Fly   184 VTGGPHFTGYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQELRIRQVVSMIQE------- 241

  Fly   216 LSSSRIHALASLYDRLLKLSELVVACNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKR------ 274
                 :|.|....:|:..||......:||.:....:..|.|.:|        |:.....      
  Fly   242 -----LHYLIQEINRVYALSLWAAMAHDLAMSTSELYILFGQSV--------GIGQQNEEENGSC 293

  Fly   275 -----YIYLVASPQ----LIINFWDFWLNIVVCDL----AGKCGDQTSKVLKLFTDLEHDD---- 322
                 |:.||..|.    ||..|:        ||.    |.:|       |:|...|  ||    
  Fly   294 YRMLGYLALVMIPPLYKLLIAPFY--------CDRTIYEARRC-------LRLVEKL--DDWFPQ 341

  Fly   323 ----EELERSLNEFAWLCTHRKFRF----------QLCGLFSINHNMGFQMIITSFL--YLVYLL 371
                ..|..||  .:|. ...|.:|          ::.|||            ||.|  ||:.|:
  Fly   342 KSSLRPLVESL--MSWR-IQAKIQFTSGLDVVLSRKVIGLF------------TSILVNYLLILI 391

  Fly   372 QF 373
            ||
  Fly   392 QF 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 87/443 (20%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 83/428 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.