DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr32a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523543.3 Gene:Gr32a / 34545 FlyBaseID:FBgn0041246 Length:461 Species:Drosophila melanogaster


Alignment Length:404 Identity:81/404 - (20%)
Similarity:149/404 - (36%) Gaps:131/404 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YGF----VLHSLAMCLAMSSHLASKQRRKYNAFERNPLLEKIYMQFQVT-----------TFFTI 101
            |.|    |:|:|.:.            ..|:.|  .|:..:::..::.|           ...|.
  Fly    91 YSFFVRGVVHALTIF------------NVYSLF--TPISAQLFFSYRETDNVNQWIELLLCILTY 141

  Fly   102 SVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQ 166
            ::.:.:....:.::.:|.||:|.|:.:|:.........||. |::|        |::.|..|   
  Fly   142 TLTVFVCAHNTTSMLRIMNEILQLDEEVRRQFGANLSQNFG-FLVK--------FLVGITAC--- 194

  Fly   167 ENSYPKILKILC-----------CLPSVGLQ------------------LIIMHFHTEIILVYRY 202
             .:|..:|||..           .|...|:|                  .|..||..:::..|.|
  Fly   195 -QAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLRIVYIRFHFINQLLNGYTY 258

  Fly   203 VWL--------------------VNETL-----EDSHHLSSSRIHALASLYDRLLKLSELVVACN 242
            ...                    ||..|     |||  |...|:|      ::||::.:.:..|.
  Fly   259 GQQHRRKEGGARARRQRGDVNPNVNPALMEHFPEDS--LFIYRMH------NKLLRIYKGINDCC 315

  Fly   243 DLQLILML--IIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFWDF-WLNIVVCDLA--- 301
            :|.|:..|  ..|.:.......|:.:.|..|        .||.::  .|.| ||.:.|..||   
  Fly   316 NLILVSFLGYSFYTVTTNCYNLFVQITGKGM--------VSPNIL--QWCFAWLCLHVSLLALLS 370

  Fly   302 GKCG------DQTSKVL-KLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQM 359
            ..||      :.||::| :::.    ..:|.:..:::|......::.:|...|.|:|:::..|::
  Fly   371 RSCGLTTTEANATSQILARVYA----KSKEYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFKI 431

  Fly   360 IITSFLYLVYLLQF 373
            ......|||.|:||
  Fly   432 FSAVTTYLVILIQF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 81/404 (20%)
Gr32aNP_523543.3 7tm_7 57..449 CDD:285581 81/404 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.