DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr23a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:403 Identity:83/403 - (20%)
Similarity:137/403 - (33%) Gaps:124/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAWFM---LQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRR 75
            |.||:   .|:.:||..:    ..|.|...:.:     |..:..|.|:..:..:.......||.:
  Fly    45 LTWFISMWTQSVIYAQTI----DCTLDCSLRHI-----LTFFQTVSHAFIVVTSFLDGFRIKQDQ 100

  Fly    76 --KYNAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNC 138
              :..|||.:                        :.|.:.||..:....|.:|     .|...|.
  Fly   101 LDEPIAFEDS------------------------DPWLAFTVLAMLVPTLGVE-----YLVCSNA 136

  Fly   139 PNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPS-VGLQLIIMHFHTEIILV--- 199
            |.:             .|.|.||.              |..||| :.||:.|:.|..|::.|   
  Fly   137 PEY-------------AFRIRIYH--------------LKTLPSFLALQVQIISFILEVMKVNIR 174

  Fly   200 -----YRYVWLVNE------TLEDSHHLSSSRIHALASLYDRLLKLSELVVACND------LQLI 247
                 .:.:.|..|      ..:.....|..:.|.:..|..|...|..|.|..|.      |.:|
  Fly   175 VRQTKLQLLILARELSCRWPQRKQKPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTII 239

  Fly   248 LMLIIYLIGNTVQIFFLI------VLGVSMNKRYIYLVASPQLIINFWDFWLNIVVC----DLAG 302
            ::.....:.|:..:|..|      :..:.:|..:|:.||. |:....|.       |    :|..
  Fly   240 IVHFAIFVSNSYWLFVDIRTRPWRIYAILLNLGFIFNVAL-QMAAACWH-------CQQSYNLGR 296

  Fly   303 KCGDQTSKVL-----KLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIIT 362
            :.|...||::     ||:.||          ::||:....|::|.......||:|.::...|...
  Fly   297 QIGCLISKLVKPQGSKLYNDL----------VSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAA 351

  Fly   363 SFLYLVYLLQFDF 375
            ...|||.|:||.|
  Fly   352 VVTYLVILIQFMF 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 80/395 (20%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 56/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.