DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr8a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:204 Identity:44/204 - (21%)
Similarity:78/204 - (38%) Gaps:46/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 IMHFHTEIILVYRYVWLVNETLEDSHHLSSSRIHALASLYDRLLKLSELVVAC--NDLQLILMLI 251
            ::.||   :.:|:.:......|....:.:.:|...:|.....|:.||.||:||  :..:.:....
  Fly     8 VLQFH---LRLYQVLGFHGLPLPGDGNPARTRRRLMAWSLFLLISLSALVLACLFSGEEFLYRGD 69

  Fly   252 IYLIGNTVQIFFLIVLGVSMNKRYIYL--VASPQLIINFWDFWLNIVVCDLAGKCGDQTSKVLKL 314
            ::...|....:....|||..    |||  ::|.:.:.|||  ||:.       |.|.|.:.::.|
  Fly    70 MFGCANDALKYVFAELGVLA----IYLETLSSQRHLANFW--WLHF-------KLGGQKTGLVSL 121

  Fly   315 FTDLEHDDEELERSLNEFAWLCTHRKFRFQL--------CGLFSI----NHNMGFQMIITSFLYL 367
                        ||  ||...|.:..|.:.:        .||:..    .|.:.|.......::|
  Fly   122 ------------RS--EFQQFCRYLIFLYAMMAAEVAIHLGLWQFQALTQHMLLFWSTYEPLVWL 172

  Fly   368 VYLLQFDFM 376
            .||....|:
  Fly   173 TYLRNLQFV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 44/204 (22%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 44/203 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.