DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr9a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:371 Identity:65/371 - (17%)
Similarity:126/371 - (33%) Gaps:124/371 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IYMQFQVTTFFTISVLLLMNVWKSNTVRKIANE------LLTLEGQVKDLLTLKNCPN------- 140
            ::::..:|.:|.:..|:.  .|..:.:.::.:.      |:.|.|:::...|.:|..|       
  Fly     3 LWLEHFLTGYFQLCGLVC--GWSGSRLGRLLSSTFLVLILIELVGEIETYFTEENPDNESVPAYF 65

  Fly   141 -----------------------FNC-----------------FVIKKHVAAIGQFVISIYFCLC 165
                                   |.|                 |:.:..:..|..|..:.:..|.
  Fly    66 AKVIMGVNMAYKMIHAWIALSALFECRRFRYLLEELPPVKATSFIYRHLILEIILFACNAFLVLS 130

  Fly   166 Q---ENSYPKILKILCCLPSVGLQLIIMHFHTEIILVYRYVWLVNETLEDSHH------------ 215
            :   ...|.:.|:....|.:|..:.:.|     ::||.|    ::..||..||            
  Fly   131 EYTIRGIYLENLRYAYSLQAVRARYLQM-----MVLVDR----LDGKLEQLHHRVISGSSDYKTL 186

  Fly   216 -----------LSSSRIHALASLYDRLLKLSELVVACNDLQLILMLIIYLIGNTVQIF--FLIVL 267
                       .|.|.:..|:.|...:|.|.:.::.||    :..::.||     |:.  .|.:.
  Fly   187 RLDYAHLAKVTRSLSHLFGLSLLLLNVLCLGDWIIVCN----VYFMVAYL-----QVLPATLFLF 242

  Fly   268 GVSMNKRYIYLVASPQLIINFWDFWLNIVVCDLAGKCGDQTSKVLKLFTDLEHDDEELERS-LNE 331
            |      .:..|..|.| |..|.      :|..:.:|..::..:.:...||. ....:||| :..
  Fly   243 G------QVMFVVCPTL-IKIWS------ICAASHRCVSKSKHLQQQLKDLP-GQTPVERSQIEG 293

  Fly   332 FAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLY----LVYLLQF 373
            ||........:..:||::.:|    .|.:...|.:    ||..|||
  Fly   294 FALQIMQDPIQIDVCGIYHLN----LQTLAGMFFFILEALVIFLQF 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 65/371 (18%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 63/365 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.