DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr22d

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster


Alignment Length:392 Identity:143/392 - (36%)
Similarity:238/392 - (60%) Gaps:21/392 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MFQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSS 67
            ||:||.|......:.:|::.||:|||||:|||.::.::::|:||.||:|:|.|:.|..:.|.:..
  Fly     1 MFRPRCGLRQKFVYVILKSILYSSWLLGIFPFKYEPKKRRLRRSMWLILFGVVISSSLLILMVKQ 65

  Fly    68 HLASKQRRKY----NAFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQ 128
               |.:.|::    :.|:||.||.:|.....|....:|..:.|..:|:|..:.:|.|.|:.||.:
  Fly    66 ---SAEDREHGIMLDVFQRNALLYQISSLMGVVGVVSICTVHLRTLWRSKHLEEIYNGLMLLEAK 127

  Fly   129 VKDLLTLKNCPNFNCFVIKKHVAAIGQFVI--SIYFCLCQENSYPKILKILCCLPSVGLQLIIMH 191
            . .......||.|:.:||:|.|..:...:.  .::|.: .::..|.:..::..:..:|..|:.:|
  Fly   128 Y-FCSNAVECPAFDGYVIQKGVVIVVGLLAPWMVHFGM-PDSKLPVLNVLVVSMVKLGTLLLALH 190

  Fly   192 FHTEIILVYRYVWLVNE-------TLEDSHHLSSSRIHALASLYDRLLKLSELVVACNDLQLILM 249
            :|..::::||:|||:|.       :|..:|..||||:..|..||::|:.|...:..|.|.|.:||
  Fly   191 YHLGVVIIYRFVWLINRELLSLVCSLRGNHKGSSSRVRFLLKLYNKLVNLYSKLADCYDCQTVLM 255

  Fly   250 LIIYLIGNTVQIFFLIVLGVSMNKR--YIYLVASPQLII-NFWDFWLNIVVCDLAGKCGDQTSKV 311
            :.|:|..|.:..|::||..:|::|.  ::.|:..|..|. ||.||||::.||||..|.|.|||.:
  Fly   256 MAIFLAANIIVCFYMIVYRISLSKMSFFVMLIMFPLAIANNFMDFWLSMKVCDLLQKTGRQTSMI 320

  Fly   312 LKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQFDFM 376
            ||||.|:|:.|::||.|:::||..|:||:|:|..||||.:|..|||:|.:.|.|||:||:|||:|
  Fly   321 LKLFNDIENMDKDLEISISDFALYCSHRRFKFLHCGLFHVNREMGFKMFVASVLYLLYLVQFDYM 385

  Fly   377 NL 378
            ||
  Fly   386 NL 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 135/373 (36%)
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 135/373 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BXVD
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I7665
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009997
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.