DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr36a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:430 Identity:76/430 - (17%)
Similarity:158/430 - (36%) Gaps:117/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 W--FMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYN 78
            |  .:|:...|...::||..|..|.:|.::..::..:|:...::.| :|:.:...::    :|:|
  Fly     4 WVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVL-ICMVLLLQIS----KKFN 63

  Fly    79 A---FERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPN 140
            .   |.|...|.:..:...|:......:..::|.|:                |...|:.|..|. 
  Fly    64 LDVYFGRANQLHQYVIIVMVSLRMASGISAILNRWR----------------QRAQLMRLVECV- 111

  Fly   141 FNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSVG----------------LQLII 189
            ...|:.|.||..:.::.|.:.|.:...:::.::...:..|..:|                :.:.|
  Fly   112 LRLFLKKPHVKQMSRWAILVKFSVGVVSNFLQMAISMESLDRLGFNEFVGMASDFWMSAIINMAI 176

  Fly   190 MHFHTEIILVYRYVWL----VNETLEDSHHLSS---------SRIHALASLYDRLLKLSELVVAC 241
            ...:..|:.|..|..|    |.:.:.:|..||.         ::...||...|.:.||.      
  Fly   177 SQHYLVILFVRAYYHLLKTEVRQAIHESQMLSEIYPRRAAFMTKCCYLADRIDNIAKLQ------ 235

  Fly   242 NDLQLILMLI----------------IYLIGNTVQIFFLIVLGVSMNKRYIYL-VASPQLIINFW 289
            |.||.|:..:                |:.:..|...:.|.:.|:    ..::| |.:..|:.:::
  Fly   236 NQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAINGI----EELHLSVRAAALVFSWF 296

  Fly   290 DFWLNIVVCDLAGKCGDQTSKVLKLFTDLE--HDDEELERSLNEFAWLCT--------------- 337
            .|:              .||.:|.||..|:  .|.:|:||.|.|.....:               
  Fly   297 LFY--------------YTSAILNLFVMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQL 347

  Fly   338 ---HRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQFD 374
               ....:.::..:|:|..:....||.:.....::|:|:|
  Fly   348 QLIRNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQYD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 75/425 (18%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 75/425 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.