DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr36b

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_724039.1 Gene:Gr36b / 117487 FlyBaseID:FBgn0045486 Length:391 Species:Drosophila melanogaster


Alignment Length:417 Identity:84/417 - (20%)
Similarity:153/417 - (36%) Gaps:91/417 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 W--FMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYN 78
            |  .:|:......:|:||..|.||.|..::.:||...:|.|:.:...:...:.:         :.
  Fly     4 WVVLLLKAVHIYCYLIGLSNFEFDCRTGRVFKSRRCTIYAFMANIFILITIIYN---------FT 59

  Fly    79 AFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTL------EGQ----VKDLL 133
            |.....||      ||........|:::|      :..||...|:|:      .||    |||::
  Fly    60 AHGDTNLL------FQSANKLHEYVIIIM------SGLKIVAGLITVLNRWLQRGQMMQLVKDVI 112

  Fly   134 TLKNC-PNFNCFV-----IKKHVA-AIGQFVISIYFCLCQENSYPKILKIL--CCLPSVGLQLII 189
            .|... |.....:     :|..:: ||....:::...........:::.:|  .|:..:....|.
  Fly   113 RLYMINPQLKSMIRWGILLKAFISFAIELLQVTLSVDALDRQGTAEMMGLLVKLCVSFIMNLAIS 177

  Fly   190 MHFHTEIILVYRYVWLVNETL----EDSHHLSSSRIHALASLYDRLLKLSELVVACNDLQLILML 250
            .|| ..|:|:.....::|..|    |:|..||..::.. .:...|...||:.:....::|..|. 
  Fly   178 QHF-LVILLIRAQYRIMNAKLRMVIEESRRLSFLQLRN-GAFMTRCCYLSDQLEDIGEVQSQLQ- 239

  Fly   251 IIYLIGNTVQIF-----------FLIVLGVSMNKRYIY--------LVASPQLI--INFWDFWLN 294
              .::|...::|           :|.::|.|.....||        |.|...:|  |....|:|:
  Fly   240 --SMVGQLDEVFGMQGLMAYSEYYLSIVGTSYMSYSIYKYGPHNLKLSAKTSIIVCILITLFYLD 302

  Fly   295 IVV-C-----------DLAGKCGDQTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCG 347
            .:| |           |..|...::|.....|...||...|.|:..|       .....:..:.|
  Fly   303 ALVNCNNMLRVLDHHKDFLGLLEERTVFASSLDIRLEESFESLQLQL-------ARNPLKINVMG 360

  Fly   348 LFSINHNMGFQMIITSFLYLVYLLQFD 374
            :|.|.......|..:..:..::|:|||
  Fly   361 MFPITRGSTAAMCASVIVNSIFLIQFD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 83/412 (20%)
Gr36bNP_724039.1 7tm_7 9..390 CDD:285581 83/412 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.