DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr59a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_726287.2 Gene:Gr59a / 117485 FlyBaseID:FBgn0045483 Length:367 Species:Drosophila melanogaster


Alignment Length:378 Identity:77/378 - (20%)
Similarity:137/378 - (36%) Gaps:96/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LGLFPFTFDSRRKQLKRSRWL-------------LLYGFVLHSL-------AMCLAMSSHLASKQ 73
            |.|.|..|....|.|..:.|:             :.|..:.::|       ||.:.:...:....
  Fly    45 LTLLPSAFWKSAKLLSTADWMPSYMRVTPYIMCTINYAAIAYTLISRCYRDAMLMDLQRIVLEVN 109

  Fly    74 RRKYNAFER-NPLLEKIYMQFQVT-TFFTISVLLLMNV--WKSNTVRKIANELLTLEGQVKDLLT 134
            |......:: |.||.:::.....| |:..:|.:|.:.:  ||:.....:.|.||     |...||
  Fly   110 REMLRTGKKMNSLLRRMFFLKTFTLTYSCLSYILAVFIYQWKAQNWSNLCNGLL-----VNISLT 169

  Fly   135 LKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSVGLQLIIMHFHTEIILV 199
            :.....|..|....|:|....||            ..::.:|:.| .|:.|:    ....|:   
  Fly   170 ILFVNTFFYFTSLWHIARGYDFV------------NQQLNEIVAC-QSMDLE----RKSKEL--- 214

  Fly   200 YRYVWLVNETLEDSHHLSSSRIH------ALASLYDRLLKLSELVVACNDLQLILMLIIYLIGNT 258
             |.:|.::..|.    .::.||:      .||..:|..  :..::.||             ||. 
  Fly   215 -RGLWALHRNLS----YTARRINKHYGPQMLAMRFDYF--IFSIINAC-------------IGT- 258

  Fly   259 VQIFFLIVLGVSMNKRY---IYLVASPQLIINFWDFWLNIVVCDLAGKCGDQTSKVLKLFTDLEH 320
              |:.......|:.|.:   ||.|.|       :||:||..:|||..:...|.    |.|.    
  Fly   259 --IYSTTDQEPSLEKIFGSLIYWVRS-------FDFFLNDYICDLVSEYQMQP----KFFA---- 306

  Fly   321 DDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQF 373
            .:..:...|:.:....:..:....:|||:.:|.....||:.:..::...|.||
  Fly   307 PESSMSNELSSYLIYESSTRLDLLVCGLYRVNKRKWLQMVGSIVVHSSMLFQF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 77/378 (20%)
Gr59aNP_726287.2 7tm_7 7..363 CDD:285581 77/378 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.