DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr59b

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:412 Identity:77/412 - (18%)
Similarity:151/412 - (36%) Gaps:104/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LAWFMLQTTLYASWLLGLFPFTFDSRR--KQLKRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRK 76
            :.::|::.....|..:|:....|.:|:  ..|....:.|:...|...:...:.....|..:|::.
  Fly     1 MVYWMIKLYFRYSLAIGITSQQFSNRKFFSTLFSRTYALIANIVTLIMLPIVMWQVQLVFQQKKT 65

  Fly    77 YNAFERNPLLEKIYMQF-QVTTFFTISVLLLMNVWKSNTVRKIANELLTL--------------- 125
            :      |.|..|.... :..:|..|...:|...::....:::...||||               
  Fly    66 F------PKLILITNNVREAVSFLVILYTVLSRGFRDTAFKEMQPLLLTLFREEKRCGFKGIGGV 124

  Fly   126 EGQVKDLLTLK------NCPNFNCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSVG 184
            ...::.||.:|      .|.....|::....|.|...|:..:| .|..|:      ||..:| :|
  Fly   125 RRSLRILLFVKFFTLSWLCVTDVLFLLYSTDALIWVNVLRFFF-KCNTNN------ILEMVP-MG 181

  Fly   185 LQLIIMHF----------------------HTEIILVYRYVWLVNETLEDSHHLSSSRIHA---L 224
            ..|.:.|.                      |.|:    :::||::..|..: .|:.::|:|   |
  Fly   182 YFLALWHIARGFDCVNRRLDQIVKSKSTRKHREL----QHLWLLHACLTKT-ALNINKIYAPQML 241

  Fly   225 ASLYDRLLKLSELVVACNDLQLILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLV-ASPQLIINF 288
            ||.:|.                       .:...:|.::..|....::..:.::| .|.|..:..
  Fly   242 ASRFDN-----------------------FVNGVIQAYWGAVFTFDLSTPFFWVVYGSVQYHVRC 283

  Fly   289 WDFWLNIVVCDLAGKCGDQTSKVLKLFTDLEHDDEELE--RSLNEFAWLCTHRKFRFQLCGLFSI 351
            .|::|...:||:|.:..|..          :|...|:.  :.::.:.......|.:...||||..
  Fly   284 LDYYLIDNMCDVAVEYHDSA----------KHSWSEVRWTKEISSYVIYANSTKLQLWSCGLFQA 338

  Fly   352 NHNMGFQMIITSFLYLVYLLQF 373
            |.:|.|.||.:...|::.||||
  Fly   339 NRSMWFAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 76/407 (19%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 76/407 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.