DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr92a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_732489.2 Gene:Gr92a / 117473 FlyBaseID:FBgn0045471 Length:386 Species:Drosophila melanogaster


Alignment Length:333 Identity:64/333 - (19%)
Similarity:122/333 - (36%) Gaps:65/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 AFERNPLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNF-- 141
            :.:.|.:|:.::....|.:...::|:|..::::...:..:.|:.|.|..||.||...|. |.|  
  Fly    74 SIKTNRVLQVLHGMRLVLSIPNVAVILCYHIFRGPEIIDLINQFLRLFRQVSDLFKTKT-PGFGG 137

  Fly   142 --NCFVIKKHVAAIGQFVISIYFCLCQENSYPKILKILCCLPSVGLQLIIMHFHT----EIILVY 200
              ...:|..::.:.......::|.:.:..|:..::...|....|....|.:|.::    .:.::|
  Fly   138 RRELILILLNLISFAHEQTYLWFTIRKGFSWRFLIDWWCDFYLVSATNIFIHINSIGYLSLGVLY 202

  Fly   201 ----RYVW---------LVNETLEDSHHLSSSRIHALASLYDRLLKLS----ELVVACNDLQLIL 248
                :||:         |.....:.......:|:....|||..:...|    :|.|....|.||.
  Fly   203 SELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLEKCISLYREIYHTSIMFHKLFVPLLFLALIY 267

  Fly   249 -MLIIYLIGNTVQI-------FFLIVLGVSMNKRYIYLVASPQLIINFWDFWLNIVVCDLAGKCG 305
             :|:|.|||..|.:       .|.|:||..:...::..|:....:..|.:..:..      |..|
  Fly   268 KVLLIALIGFNVAVEFYLNSFIFWILLGKHVLDLFLVTVSVEGAVNQFLNIGMQF------GNVG 326

  Fly   306 D-----QTSKVLKLFTDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFL 365
            |     .|...|.|...|.|                    ||..:.|||.:......|.:.....
  Fly   327 DLSKFQTTLDTLFLHLRLGH--------------------FRVSILGLFDVTQMQYLQFLSALLS 371

  Fly   366 YLVYLLQF 373
            .|.::.|:
  Fly   372 GLAFIAQY 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 64/333 (19%)
Gr92aNP_732489.2 7tm_7 18..382 CDD:285581 64/333 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.