DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr93b

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_732664.2 Gene:Gr93b / 117472 FlyBaseID:FBgn0045470 Length:395 Species:Drosophila melanogaster


Alignment Length:395 Identity:81/395 - (20%)
Similarity:149/395 - (37%) Gaps:79/395 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LYASWLLGLFPFTFDSRRKQL-----KRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYNAFER 82
            ||.:: .|:..|..:.:..||     :...|:.|   |:..||.|....|         |:|:..
  Fly    29 LYGTF-FGVITFRIERKDSQLVAINRRGYLWICL---VIRLLASCFYGYS---------YDAWSG 80

  Fly    83 NPLLEKIYMQ----FQVTTFFTISVLLL-MNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFN 142
            .  .|.:|::    |::......||::| |..|....:..:.|..|.|   .:.:.:|.|.|. |
  Fly    81 Q--YEDMYLRAFFGFRLIGCLICSVIILVMQFWFGEELINLVNRFLQL---FRRMQSLTNSPK-N 139

  Fly   143 CFVIKKHVAAIGQFVISIYFCLCQENSY--PKILKILCC--LPSVGLQLIIMHF----HTEIILV 199
            .|..:.....:...|.|:.|........  |..|..|.|  ..|||..: |.|.    :..|.::
  Fly   140 RFGDRAEFLLMFSKVFSLLFVFMAFRLMLSPWFLLTLVCDLYTSVGTGM-ITHLCFVGYLSIGVL 203

  Fly   200 YR----YVWL-----------VNETLEDSHHLSSSRIHALAS---LYDRLLKLSELVVACNDLQL 246
            ||    ||..           .|.:..::...:...|..|..   |||.:.::|.......||.|
  Fly   204 YRDLNNYVDCQLRAQLRSLNGENNSFRNNPQPTRQAISNLDKCLYLYDEIHQVSRSFQQLFDLPL 268

  Fly   247 ILMLIIYLIGNTVQIFFLIVLGVSMNKRYIYLVASPQLIINFW----DFWLNIVVCDLAGKCGDQ 307
            .|.|...|:..::..:..|     :.::|.:         |.|    ...:::|:..::......
  Fly   269 FLSLAQSLLAMSMVSYHAI-----LRRQYSF---------NLWGLVIKLLIDVVLLTMSVHSAVN 319

  Fly   308 TSKVLKLFTDLEH----DDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLV 368
            .|::::..: .|:    |.:...:.|..|.....|::.|....|||.:::.:....:.....|||
  Fly   320 GSRLIRRLS-FENFYVTDSQSYHQKLELFLGRLQHQELRVFPLGLFEVSNELTLFFLSAMVTYLV 383

  Fly   369 YLLQF 373
            :|:|:
  Fly   384 FLVQY 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 81/395 (21%)
Gr93bNP_732664.2 7tm_7 24..391 CDD:285581 81/395 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.