DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr93d

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_732666.1 Gene:Gr93d / 117470 FlyBaseID:FBgn0045468 Length:381 Species:Drosophila melanogaster


Alignment Length:415 Identity:74/415 - (17%)
Similarity:134/415 - (32%) Gaps:176/415 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RSRW-----------LLLYGFV---------------LHSLAMCLAMSSHLASKQRRKYNAFERN 83
            ||||           |.:|.|.               |||.::.:::..:|:             
  Fly    45 RSRWKWISVTLRIVPLCIYAFTYAEWISNRMLITEKFLHSCSLVVSIPCYLS------------- 96

  Fly    84 PLLEKIYMQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKNCPNFNCFVIKK 148
                                ::.:.:.....|.|:.|:.|                         
  Fly    97 --------------------IIHLKICHGPEVTKLVNQYL------------------------- 116

  Fly   149 HVAAIGQ---------------FVISIYFCLCQENSYPKILKI---LCCLPSVGLQLIIMHF-HT 194
            |:..:|.               |::.:..| ||.:.|..||.|   ||     |.|.||... :|
  Fly   117 HIFRLGTLDIRRRSQFGGGRELFLLILSVC-CQIHEYVFILVIASRLC-----GFQHIIWWVSYT 175

  Fly   195 EI------ILVYRYVW-----LVNETLEDSHHLSSS------------RIHALASLYDRLLKLSE 236
            .:      |:.:.::|     ::...|.|:....|.            |:....:|:.   ::|.
  Fly   176 YVFIICNSIMCFGFIWHLSLGVLYAELNDNLRFESGFQTAFLRKQQRIRVQKSMALFK---EISS 237

  Fly   237 LVVACNDL---QLILMLIIYLIGNTVQIFFLIV-LGVSMNKRYIYLVASPQLIINFWDFWLNIVV 297
            :|.:..|:   .|.|..::.|:...|..:.:|: ||.|              ....|.|.|..::
  Fly   238 VVTSLQDIFNVHLFLSALLTLLQVLVVWYKMIIDLGFS--------------DFRIWSFSLKNLI 288

  Fly   298 CDLAGKCGDQTSKVLKLFTDLEHDDEELERSLNEFA------WL------CTH---RKFRFQLCG 347
            ..|.        .||.:........:..||:|:.|.      |:      .||   .:||..|.|
  Fly   289 QTLL--------PVLAIQEAANQFKQTRERALDIFLVGKSKHWMKSVEIFVTHLNLSEFRVNLLG 345

  Fly   348 LFSINHNMGFQMIITSFLYLVYLLQ 372
            ||::::.:...::...|.|||::.|
  Fly   346 LFNVSNELFLIIVSAMFCYLVFVTQ 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 74/415 (18%)
Gr93dNP_732666.1 7tm_7 11..375 CDD:285581 74/415 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.