DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr39b

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_724336.1 Gene:Gr39b / 117347 FlyBaseID:FBgn0041245 Length:369 Species:Drosophila melanogaster


Alignment Length:378 Identity:69/378 - (18%)
Similarity:128/378 - (33%) Gaps:123/378 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RNPLLEKIY---------MQFQVTTFFTISVLLLMNVWKSNTVRKIANELLTLEGQVKDLLTLKN 137
            ::..::|:|         :.|.::.:|..|..|.:::.                           
  Fly    26 QSKFVQKVYSAILIILNAVHFGISIYFPQSAELFLSLM--------------------------- 63

  Fly   138 CPNFNCFVIKKHVAAIGQFVISI------YFCLCQE---------------------NSYPKILK 175
               .|..|....:..:...::.:      ||..|:|                     .||.|||.
  Fly    64 ---VNVIVFVARIVCVTVIILQVMVHYDDYFRFCREMKYLGLRLQCELKIHVGRLKWQSYAKILA 125

  Fly   176 -----ILCCLPS--VGLQLIIMHFHTEI--ILVYRYVW---LVNETLEDSH-------------- 214
                 ::..|||  |.|...:::|.:.:  ||:.|..:   |:|..|...|              
  Fly   126 LGIGFLVTVLPSIYVALSGSLLYFWSSLLSILIIRMQFVLVLLNVELLGHHVSLLGIRLQNVLEC 190

  Fly   215 HLSSSR------------IHALASLYDRLLKLSELVVACNDL---QLILMLIIYLIGNTVQIFFL 264
            ||..:.            :..|.:|....::|..|....|||   .::...::....:||.|::.
  Fly   191 HLMGANCTLDGNANRLCSLEFLLALKQSHMQLHYLFTHFNDLFGWSILGTYVVLFSDSTVNIYWT 255

  Fly   265 IVLGVSMNKRYIYLVASPQLIINFWDFWLNIVVCDLAGKCGD--QTSKVL--KLFTDLE-HDDEE 324
            ..:.|.:.: |.||.|:..:.:.  .|:..:|.|    :||:  |...||  ....:|. |....
  Fly   256 QQVLVEVYE-YKYLYATFSVFVP--SFFNILVFC----RCGEFCQRQSVLIGSYLRNLSCHPSIG 313

  Fly   325 LERS----LNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQF 373
            .|.|    |.||..............|..|.::::...::.....||:.|:||
  Fly   314 RETSYKDLLMEFILQVEQNVLAINAEGFMSTDNSLLMSILAAKVTYLIVLMQF 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 69/378 (18%)
Gr39bNP_724336.1 7tm_7 5..367 CDD:303125 69/378 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.