DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr39a

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_724330.1 Gene:Gr39a / 117346 FlyBaseID:FBgn0264556 Length:381 Species:Drosophila melanogaster


Alignment Length:430 Identity:94/430 - (21%)
Similarity:168/430 - (39%) Gaps:118/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FQPRRGFSCHLAWFMLQTTLYASWLLGLFPFTFDSRRKQLKRSRWLLLY--GFVLHS-LAMCLAM 65
            |||  |..|  |::.|      ...||:|...::..:|:.:..|.:|.|  .|.|.: |..|:::
  Fly     3 FQP--GELC--AYYRL------CRYLGIFCIDYNPTKKKFRLRRSVLCYIVHFALQAYLVGCISV 57

  Fly    66 SSHLASKQRRKY--------NAFERNPLLEKIYMQFQVTTFFTISVLLLMNVW-------KSNTV 115
               :.:..||.:        |.|:|            :.....:.:|::.|.|       ....|
  Fly    58 ---MVTYWRRCFKSELTTTGNHFDR------------LVMVIALGILVVQNAWLIWLQAPHLRIV 107

  Fly   116 RKI--------ANELLTLEGQVKDLLTLKNCPNFNCFVIKKHVAAIGQFVISIYFCLCQENS--- 169
            |:|        ||..|.|.   |.||.|         :|..:|..:..|:.:..|....:.|   
  Fly   108 RQIEFYRRNHLANVRLLLP---KRLLWL---------IIATNVVYMANFIKTCIFEWLTDASRLF 160

  Fly   170 ------YPKILKILCCLPSVGLQLIIMHFHTEIILVYRYV--W---LVNETLEDSHHLSSS---- 219
                  :|  |:.|....::|....::|       :.|.|  |   .:|..:::|..|..:    
  Fly   161 VITSLGFP--LRYLVTSFTMGTYFCMVH-------IVRLVLDWNQSQINAIIDESADLKMTSPNR 216

  Fly   220 -RIHALASLYDRLLKLSELVVACND-LQLILMLIIYL------IGNTVQIFFLIVLGVSMNKRYI 276
             |:.....::|||:.|      ||| :.|:...|.:|      :..|..|:..:|:   ..|:.|
  Fly   217 LRLRVCLEMHDRLMLL------CNDEISLVYGFIAWLSWMFASLDVTGVIYLTMVI---QTKKSI 272

  Fly   277 YLVASPQLIINFWDFWLN--IVVCD---LAGKCGDQTSKVLKLFTDLEHDDEELERSLNEFAWLC 336
            .|    :||.|.  .||:  .:.|.   ::.:...|.:|..|:.|.:......|:|.:.:|....
  Fly   273 VL----KLITNV--VWLSPTFMTCAASFMSNRVTIQANKTAKMLTKVPRTGTGLDRMIEKFLLKN 331

  Fly   337 THRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQFDFM 376
            ..:|......|.|:::.:..|::....|.|:|.|:||..|
  Fly   332 LRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKEM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 88/415 (21%)
Gr39aNP_724330.1 7tm_7 8..372 CDD:285581 90/423 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.