DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr98c

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524531.2 Gene:Gr98c / 117336 FlyBaseID:FBgn0046886 Length:408 Species:Drosophila melanogaster


Alignment Length:430 Identity:89/430 - (20%)
Similarity:156/430 - (36%) Gaps:139/430 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LLGLFP----FTFDSRRKQLKRSRWLLLYGFVLHSLAMCL---------AMSSHLASKQRRKYNA 79
            |.||.|    ||    |...||.|:..:.|:.|:.:|:.|         .:|.||   :..|::.
  Fly    23 LFGLTPPAEFFT----RTLRKRRRFCWMAGYSLYLIAILLMVFYEFHANIVSLHL---EIYKFHV 80

  Fly    80 FERNPLLEKIYMQFQVTTFFTISVL-LLMNVWKSNTV-RKIANELLTLEGQVKDLLTLKNCPNFN 142
            .:.:.::.:. .:|.:....|.:.| :|:|..:...: .:|||..|.::...|:           
  Fly    81 EDFSKVMGRT-QKFLIVAIATCNQLNILLNYGRLGLIYDEIANLDLGIDKSSKN----------- 133

  Fly   143 CFVIKKH--------VAAIGQFVISIYFCLCQENSYPKILKILCCLPSVGLQLIIMHFH------ 193
             |..|.|        ..:||.:::.                |:..:|.:.|......||      
  Fly   134 -FCGKSHWWSFRLRLTLSIGLWMVI----------------IIGVIPRLTLGRAGPFFHWVNQVL 181

  Fly   194 TEIILVY---------RYVWLVNETLEDSHHLSSSRIHALASLYDRL------LKLSELVVACND 243
            |:|||:.         .:|.||.|.:..:.|:       |..|.|.|      .::.||.|....
  Fly   182 TQIILIMLQLKGPEYCLFVLLVYELILRTRHV-------LEQLKDDLEDFDCGARIQELCVTLKQ 239

  Fly   244 LQLILMLIIYLIGN-------TVQIFFLIVLGVSMNKRYIYLVASPQLI---------------- 285
            .||::..|..|:..       ::.:.||      .|...|..|.:..:|                
  Fly   240 NQLLIGRIWRLVDEIGAYFRWSMTLLFL------YNGLTILHVVNWAIIRSIDPNDCCQLNRLGS 298

  Fly   286 INFWDFWLNIVVCDLAGKCGDQTSKVLKLFTDLEH------------DDEELERSLNEFAWLCTH 338
            |.|..|.| ::.|..:..|       :|.:..:.:            :.:.|:..|.|:.....|
  Fly   299 ITFLSFNL-LLTCFFSECC-------VKTYNSISYILHQIGCLPTAEEFQMLKMGLKEYILQMQH 355

  Fly   339 RKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQF---DF 375
            .|..|...|||.||..:...|::|...|::.::||   ||
  Fly   356 LKLLFTCGGLFDINIKLFGGMLVTLCGYVIIIVQFKIQDF 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 89/430 (21%)
Gr98cNP_524531.2 7tm_7 15..393 CDD:285581 87/426 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.