DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22f and Gr98b

DIOPT Version :9

Sequence 1:NP_722729.2 Gene:Gr22f / 117349 FlyBaseID:FBgn0041249 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_733213.1 Gene:Gr98b / 117327 FlyBaseID:FBgn0046887 Length:403 Species:Drosophila melanogaster


Alignment Length:386 Identity:88/386 - (22%)
Similarity:155/386 - (40%) Gaps:90/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KRSRWLLLYGFVLHSLAMCLAMSSHLASKQRRKYNAFERNPLLEKIYMQFQVTTFFTISVLLLMN 108
            :|.||.|:.|:|.::.|:       ||:.....|  |....:.|:: :::.|:.|..:    :.|
  Fly    37 RRLRWYLMTGYVFYATAI-------LATVFIVSY--FNIIAIDEEV-LEYNVSDFTRV----MGN 87

  Fly   109 VWKS-NTVRKIANEL------LTLEGQVKDLLTLKNCPN--FNCFVIKKHVAAIGQFVISIYFCL 164
            :.|| .::..|||.|      ..|.|..||:..|:...:  ..||..::.     :|.......|
  Fly    88 IQKSLYSIMAIANHLNMLINYRRLGGIYKDIADLEMDMDEASQCFGGQRQ-----RFSFRFRMAL 147

  Fly   165 C-------QENSYPK------------ILKILCCLPSVGLQLIIMHFHTEIILVYRYVWLVNETL 210
            |       ...|.|:            :||||.....:..||..:.:...::::|..|..:..||
  Fly   148 CVGVWMILMVGSMPRLTMTAMGPFVSTLLKILTEFVMIMQQLKSLEYCVFVLIIYELVLRLRRTL 212

  Fly   211 EDSHHLSSSRIHALASLYDRLLKLSELVVACNDLQLILMLIIYLIGN-------TVQIFFL---I 265
                    |::.......::...|..|.||....||:|..|..|.|:       |:.:.||   :
  Fly   213 --------SQLQEEFQDCEQQDMLQALCVALKRNQLLLGRIWRLEGDVGSYFTPTMLLLFLYNGL 269

  Fly   266 VLGVSMNKRYI-------------YLVASPQLIINFWDFWLNIVVCDLAGKCGDQTSKVLKLF-- 315
            .:...:|..||             :||.| .|::|.      ::.|.|:.:|.:..:...::.  
  Fly   270 TILHMVNWAYINKFLYDSCCQYERFLVCS-TLLVNL------LLPCLLSQRCINAYNCFPRILHK 327

  Fly   316 ---TDLEHDDEELERSLNEFAWLCTHRKFRFQLCGLFSINHNMGFQMIITSFLYLVYLLQF 373
               |..:.:...|.|.|.|::....|.|.||...|||.||......:::|.|.|::.|:||
  Fly   328 IRCTSADPNFAMLTRGLREYSLQMEHLKLRFTCGGLFDINLKYFGGLLVTIFGYIIILIQF 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22fNP_722729.2 7tm_7 19..377 CDD:285581 88/386 (23%)
Gr98bNP_733213.1 7tm_7 13..391 CDD:285581 88/386 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.