DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr93a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_524442.2 Gene:Gr93a / 42568 FlyBaseID:FBgn0041229 Length:419 Species:Drosophila melanogaster


Alignment Length:382 Identity:79/382 - (20%)
Similarity:138/382 - (36%) Gaps:91/382 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RQRLVSIIQNNIVVDEIFVRLGMKLDYRRI--LLSSFLISLGMLLF-NVIYLCVSYSLLVSATIS 171
            |.|.:.|:...|||          :.|..:  :|:|.:|...:..: :|:.|..|.|:.:.|.||
  Fly    53 RNRFLHILWRCIVV----------MIYAGLWPMLTSAVIGKRLESYADVLALAQSMSVSILAVIS 107

  Fly   172 PSFVTFTTFALPH------INISLMVFKFLCTTDLARSRF-----------------SMLNEILQ 213
                 |...|...      :|..|.:::.:|.|...|..|                 ...:||:.
  Fly   108 -----FVIQARGENQFREVLNRYLALYQRICLTTRLRHLFPTKFVVFFLLKLFFTLCGCFHEIIP 167

  Fly   214 DILDAHIEQLS-----------------ALELSPMHSVVNHRRYSHRLRNLIS-----TPM---- 252
            ...::|.:.:|                 .|:...:..:|:...|.|...|:|:     .|:    
  Fly   168 LFENSHFDDISQMVGTGFGIYMWLGTLCVLDACFLGFLVSGILYEHMANNIIAMLKRMEPIESQD 232

  Fly   253 KRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEE---------YFTYPLLGIIAISFLFILFD 308
            :||.:|...|:             .||||....::|         :.|.....|:....||.::.
  Fly   233 ERYRMTKYRRM-------------QLLCDFADELDECAAIYSELYHVTNSFRRILQWQILFYIYL 284

  Fly   309 DFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHKILNIT 373
            :|..:..:|....|.....||.....::.....:..:||::..:..|:..|.....:...|: .:
  Fly   285 NFINICLMLYQYILHFLNDDEVVFVSIVMAFVKLANLVLLMMCADYTVRQSEVPKKLPLDIV-CS 348

  Fly   374 DDPELRDRLFRLSL-QLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRFT 429
            |..|..|:.....| ||..:::.....|.|.|:...|..|..|...||.|||||..|
  Fly   349 DMDERWDKSVETFLGQLQTQRLEIKVLGFFHLNNEFILLILSAIISYLFILIQFGIT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 79/382 (21%)
Gr93aNP_524442.2 7tm_7 46..405 CDD:303125 78/380 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.