DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr68a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_524027.2 Gene:Gr68a / 39324 FlyBaseID:FBgn0041231 Length:389 Species:Drosophila melanogaster


Alignment Length:417 Identity:91/417 - (21%)
Similarity:154/417 - (36%) Gaps:103/417 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LFFVLCFGISVKEGDSIIGYFFQTNITRFSDGTLRLTGILAMSTIFGFAMF--KRQRLVSIIQNN 120
            :|.:|.|    ..||...|:.| ..:.|:....:.|..::...|:....:|  |..|||:..|.:
  Fly    16 IFAILPF----YSGDVDDGFRF-GGLGRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGD 75

  Fly   121 I-VVDEIFVRLGMKLDYRRILLSS-------------------FLISLGMLLFNVIYLCVSYSLL 165
            . .::.....|...:.|..::|||                   :|::.|   |...|.|.:.::|
  Fly    76 TEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANG---FRETYSCRNLTIL 137

  Fly   166 VSATISPSFVTFTTFALPHIN---------ISLMVF--KFLCTTDLARSRFSMLNEILQDI--LD 217
            |  |.:...|....|...|..         |.|:::  :.|.:|.||....:::..:.|.|  |:
  Fly   138 V--TSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLN 200

  Fly   218 AHIEQLSALELSPMHSVVNHRRYSHRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDI 282
               ::|....|.....:.|.|                                ::||:..:||..
  Fly   201 ---QKLDTFNLQDCGHMENWR--------------------------------ELSNLIEVLCKF 230

  Fly   283 CQTIEEYFTYPLLGIIAISFLFILFDDFYILEAILNPKRL--------DVFEADEFFAFFLMQLI 339
                 .|.|..:..:..:|.||.....||   .:.|...|        .:....|......:..|
  Fly   231 -----RYITENINCVAGVSLLFYFGFSFY---TVTNQSYLAFATLTAGSLSSKTEVADTIGLSCI 287

  Fly   340 WYIV-IIVLIVEGSSRTILHSSY--TAAIVHKILNITDD-PELRDRLFRLSLQLSHRKVLFTAAG 400
            |.:. .|.:||..|:...|.|..  ||.|:.:|...:.. ..|.|:....|::   :.:.|||.|
  Fly   288 WVLAETITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIK---QDLQFTAYG 349

  Fly   401 LFRLDRTLIFTITGAATCYLIILIQFR 427
            .|.:|.:.:|.|..|.|.||:|||||:
  Fly   350 FFSIDNSTLFKIFSAVTTYLVILIQFK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 91/417 (22%)
Gr68aNP_524027.2 7tm_7 7..379 CDD:285581 91/417 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.