DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr59f

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_788432.1 Gene:Gr59f / 37726 FlyBaseID:FBgn0041234 Length:406 Species:Drosophila melanogaster


Alignment Length:455 Identity:83/455 - (18%)
Similarity:166/455 - (36%) Gaps:122/455 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ERFSQADNVFQALRPLTFISLL-GLAPFRLNLN-PRKEVQTSKFSFFAGIVHFLFFVLCFGISVK 69
            ||:.:   :::.|..|..||:| ..||..:... |.:         |..:||..:.:|.:|:.| 
  Fly    28 ERYKE---LYRTLFWLLLISVLANTAPITILPGCPNR---------FYRLVHLSWMILWYGLFV- 79

  Fly    70 EGDSIIGYFFQ--------TNITRFSDGTLRLTGILAMSTIFGFAMFKRQ--RLVSIIQNNIVVD 124
                 :|.:::        .::.|:.:.   :...:.:..||...:...|  .....:..|||..
  Fly    80 -----LGSYWEFVLVTTQRVSLDRYLNA---IESAIYVVHIFSIMLLTWQCRNWAPKLMTNIVTS 136

  Fly   125 EIFVRLGMKLDYRR----ILLSSFLISLGMLL---FN------VIYLCVSYSLLVSATISPSFVT 176
            ::  .....:|..|    |.|..||:.:...|   ||      |:|..:   |.:::.:.|:.::
  Fly   137 DL--NRAYTIDCNRTKRFIRLQLFLVGIFACLAIFFNIWTHKFVVYRSI---LSINSYVMPNIIS 196

  Fly   177 FTTFALPHINISLMVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYS 241
            ..:||..::.:..:.::                   |..|...:|:    ||:.:||        
  Fly   197 SISFAQYYLLLQGIAWR-------------------QRRLTEGLER----ELTHLHS-------- 230

  Fly   242 HRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFIL 306
                       .|.|....||::           |..|.|..:.:...|.|.:|.:....||...
  Fly   231 -----------PRISEVQKIRMH-----------HANLIDFTKAVNRTFQYSILLLFVGCFLNFN 273

  Fly   307 FDDFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIVHK--- 368
            ...|.:.:.|.||...|       |..::..|:|..:.:     |...:|||.:.:....|.   
  Fly   274 LVLFLVYQGIENPSMAD-------FTKWVCMLLWLAMHV-----GKVCSILHFNQSIQNEHSTCL 326

  Fly   369 -ILNITD--DPELRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRFTH 430
             :|:...  ..:::|.:....:|:..........|:..||...:.|:..|:..:.|.|:|:..|:
  Fly   327 TLLSRVSYARKDIQDTITHFIIQMRTNVRQHVVCGVINLDLKFLTTLLVASADFFIFLLQYDVTY 391

  Fly   431  430
              Fly   392  391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 79/438 (18%)
Gr59fNP_788432.1 7tm_7 61..388 CDD:303125 72/414 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.