DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr57a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_523798.1 Gene:Gr57a / 37347 FlyBaseID:FBgn0041240 Length:416 Species:Drosophila melanogaster


Alignment Length:463 Identity:97/463 - (20%)
Similarity:170/463 - (36%) Gaps:105/463 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSQADNVFQALRPLTFIS-LLGLAPFRLNLNPRKEVQTSK-FSFFAGIVHFLFFVLCFGISVKEG 71
            |.:.:.||.....:..:. |:|...|.:..:..:....|: :|....|..|........:.:.|.
  Fly     7 FREPETVFDCAAFICILQFLMGCNGFGIRRSTFRISWASRIYSMSVAIAAFCCLFGSLSVLLAEE 71

  Fly    72 DSIIGYFFQTNITRFSDGTLRLTGI-LAMST-IFGFAMFKRQ----RLVSIIQNNIVVD-EIFVR 129
            |      .:..:.:..:..|.::.: |.||| :||..:...|    |.:.|.|....:| .:...
  Fly    72 D------IRERLAKADNLVLSISALELLMSTLVFGVTVISLQVFARRHLGIYQRLAALDARLMSD 130

  Fly   130 LGMKLDYRRILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTFAL--------PHIN 186
            .|..|:||::|..:..: ||::  ..|||....|..|... |.....|..|||        ||..
  Fly   131 FGANLNYRKMLRKNIAV-LGIV--TTIYLMAINSAAVQVA-SGHRALFLLFALCYTIVTGGPHFT 191

  Fly   187 ISLMVFKFLCTTDLARSRFSMLNEILQ-DILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLIST 250
                .:..:...::...||.:|.::|| :.|:....||...||              |:|.::| 
  Fly   192 ----GYVHMTLAEMLGIRFRLLQQLLQPEFLNWRFPQLHVQEL--------------RIRQVVS- 237

  Fly   251 PMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTYPLLGIIA------ISFLFILFDD 309
                                .:..:|.|:    |.|...:...|...:|      .|.|:|||. 
  Fly   238 --------------------MIQELHYLI----QEINRVYALSLWAAMAHDLAMSTSELYILFG- 277

  Fly   310 FYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIV------LIVEG--SSRTILHSSYTAAIV 366
                      :.:.:.:.:|.......:::.|:.:::      |::..  ..|||..:.....:|
  Fly   278 ----------QSVGIGQQNEEENGSCYRMLGYLALVMIPPLYKLLIAPFYCDRTIYEARRCLRLV 332

  Fly   367 HKILNITDD--PE---LRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQF 426
            .|:    ||  |:   ||..:..|.......|:.||:.....|.|.:|...|.....||:|||||
  Fly   333 EKL----DDWFPQKSSLRPLVESLMSWRIQAKIQFTSGLDVVLSRKVIGLFTSILVNYLLILIQF 393

  Fly   427 RFTHHMDD 434
            ..|..|.:
  Fly   394 AMTQKMGE 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 92/444 (21%)
Gr57aNP_523798.1 7tm_7 32..397 CDD:303125 90/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.