DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr23a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_787965.1 Gene:Gr23a / 33453 FlyBaseID:FBgn0041248 Length:374 Species:Drosophila melanogaster


Alignment Length:385 Identity:80/385 - (20%)
Similarity:138/385 - (35%) Gaps:105/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 FVRLGMKLDYRRI-LLSSFLISLGMLLF-------NVIYL--------C-VSYSLLVSATISPSF 174
            |:.:...|..||: .|..:|..||.|.:       :|||.        | :.:.|....|:|.:|
  Fly    20 FILVAFSLRSRRLSRLVLWLQFLGWLTWFISMWTQSVIYAQTIDCTLDCSLRHILTFFQTVSHAF 84

  Fly   175 VTFTTF-------------------------------ALPHINISLMVFKFLCTT--DLA-RSRF 205
            :..|:|                               .:|.:.:..:|    |:.  :.| |.|.
  Fly    85 IVVTSFLDGFRIKQDQLDEPIAFEDSDPWLAFTVLAMLVPTLGVEYLV----CSNAPEYAFRIRI 145

  Fly   206 SMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLIST-------PMKRYSVTSVIRL 263
            ..| :.|...|...::.:|.: |..|.  ||.|....:|:.||..       |.::.        
  Fly   146 YHL-KTLPSFLALQVQIISFI-LEVMK--VNIRVRQTKLQLLILARELSCRWPQRKQ-------- 198

  Fly   264 NPEYA------IKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFILFDDFYILEAI-LNPKR 321
            .|:::      :|.:...:|.|..:...|..||...||.||.:.|...:.:.:::...| ..|.|
  Fly   199 KPQFSDQQAHRVKDLKRRYNDLHYLFVRINGYFGGSLLTIIIVHFAIFVSNSYWLFVDIRTRPWR 263

  Fly   322 LDVFEADEFFAF-FLMQL---IWYIVIIVLIVEGSSRTILHSSYT-----AAIVHKILNITDDPE 377
            :.....:..|.| ..:|:   .|:               ...||.     ..::.|::.......
  Fly   264 IYAILLNLGFIFNVALQMAAACWH---------------CQQSYNLGRQIGCLISKLVKPQGSKL 313

  Fly   378 LRDRLFRLSLQLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQFRFTHHMDDTSS 437
            ..|.:...|||..|::.:.||...|.|:..|:.::..|...||:|||||.|........|
  Fly   314 YNDLVSEFSLQTLHQRFVVTAKDFFSLNLHLLSSMFAAVVTYLVILIQFMFAERSSTRGS 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 79/376 (21%)
Gr23aNP_787965.1 7tm_7 <141..362 CDD:285581 53/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.