DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr8a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_511097.3 Gene:Gr8a / 31865 FlyBaseID:FBgn0030108 Length:385 Species:Drosophila melanogaster


Alignment Length:299 Identity:60/299 - (20%)
Similarity:117/299 - (39%) Gaps:71/299 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTFALPHINISLMVFKFLCTTDLARS 203
            ::.:...|.||:..|..:   ..:.||..:|..|                     .:..|.|...
  Fly   138 MMAAEVAIHLGLWQFQAL---TQHMLLFWSTYEP---------------------LVWLTYLRNL 178

  Fly   204 RFSMLNEILQDILDAHIEQLSALELSPMHSVVNHRRYSHRLRNLISTPMKRYSVTSVIRLNPEYA 268
            :|.:..|:|:       |||:.|| ..|..:..:.|::.....  |.|    ...|.:|..    
  Fly   179 QFVLHLELLR-------EQLTGLE-REMGLLAEYSRFASETGR--SFP----GFESFLRRR---- 225

  Fly   269 IKQVSNIHNLLCDICQTIEEYFTYPLLGIIAISFLFILFDDFYILEAILNPKRLDVFEADEFFAF 333
            :.|...|::.:.|:.:..:..|.:.:|.::....:.|..|.:::..:|.|    :|...|     
  Fly   226 LVQKQRIYSHVYDMLKCFQGAFNFSILAVLLTINIRIAVDCYFMYYSIYN----NVINND----- 281

  Fly   334 FLMQLIWYIVIIVLIVEGSSRTILHSSYTAAIV-----HKILNITDD------PELRDRLFRLSL 387
                  :|:::..|:   .....:::|.:..:|     |::.||..|      |:|..::...||
  Fly   282 ------YYLIVPALL---EIPAFIYASQSCMVVVPRIAHQLHNIVTDSGCCSCPDLSLQIQNFSL 337

  Fly   388 QLSHRKVLFTAAGLFRLDRTLIFTITGAATCYLIILIQF 426
            ||.|:.:.....||..||.:|:..:..:...|:|..|||
  Fly   338 QLLHQPIRIDCLGLTILDCSLLTRMACSVGTYMIYSIQF 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 60/299 (20%)
Gr8aNP_511097.3 7tm_7 9..376 CDD:285581 58/297 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.