DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr9a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_727392.1 Gene:Gr9a / 318158 FlyBaseID:FBgn0052693 Length:341 Species:Drosophila melanogaster


Alignment Length:391 Identity:83/391 - (21%)
Similarity:153/391 - (39%) Gaps:82/391 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 HFL--FFVLCFGISVKEGDSIIGYFFQTNITRFSDGTLRLTGILAMSTIFGFAMFKRQRLVSIIQ 118
            |||  :|.|| |:       :.|:          .|: || |.|..||.....:.:   ||..|:
  Fly     7 HFLTGYFQLC-GL-------VCGW----------SGS-RL-GRLLSSTFLVLILIE---LVGEIE 48

  Fly   119 --------NNIVVDEIFVR--LGMKLDYRRILLSSFLISLGMLLFNVIYLCVSYSLLVSATISPS 173
                    :|..|...|.:  :|:.:.|:.|        ...:..:.::.|..:..|:. .:.| 
  Fly    49 TYFTEENPDNESVPAYFAKVIMGVNMAYKMI--------HAWIALSALFECRRFRYLLE-ELPP- 103

  Fly   174 FVTFTTFALPHINISLMVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNHR 238
             |..|:|...|:.:.:::  |.|...|..|.:::....|:::..|:  .|.|:....:..:|...
  Fly   104 -VKATSFIYRHLILEIIL--FACNAFLVLSEYTIRGIYLENLRYAY--SLQAVRARYLQMMVLVD 163

  Fly   239 RYSHRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYF--TYPLLGIIAIS 301
            |...:|..|....:...|....:||  :||       |  |..:.:::...|  :..||.::.:.
  Fly   164 RLDGKLEQLHHRVISGSSDYKTLRL--DYA-------H--LAKVTRSLSHLFGLSLLLLNVLCLG 217

  Fly   302 FLFILFDDFYILEAILN--PKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRTILHSSYTAA 364
            . :|:..:.|.:.|.|.  |..|.:|....|.....:..||      .|...|.|.:..|.:...
  Fly   218 D-WIIVCNVYFMVAYLQVLPATLFLFGQVMFVVCPTLIKIW------SICAASHRCVSKSKHLQQ 275

  Fly   365 IVHKILNITDDPELRDRLFRLSLQLSHRKVLFTAAGLFRLD-RTL---IFTITGAATCYLIILIQ 425
            .:..:...|  |..|.::...:||:....:.....|::.|: :||   .|.|..|    |:|.:|
  Fly   276 QLKDLPGQT--PVERSQIEGFALQIMQDPIQIDVCGIYHLNLQTLAGMFFFILEA----LVIFLQ 334

  Fly   426 F 426
            |
  Fly   335 F 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 83/391 (21%)
Gr9aNP_727392.1 7tm_7 7..335 CDD:285581 81/389 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.