DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr28a and Gr10a

DIOPT Version :9

Sequence 1:NP_523504.2 Gene:Gr28a / 117348 FlyBaseID:FBgn0041247 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_727523.1 Gene:Gr10a / 117501 FlyBaseID:FBgn0045502 Length:408 Species:Drosophila melanogaster


Alignment Length:401 Identity:79/401 - (19%)
Similarity:143/401 - (35%) Gaps:117/401 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GYF---FQTNITRFSDGTLRLTGILAM-STIFGFAMFKRQRLVSIIQNNIVVDEIFVRLGM---- 132
            |||   |:| :|...|..|:|...::. :|...:|..    :|:.:.|.:..:.|..|..|    
  Fly    67 GYFCYHFRT-LTDTLDRRLQLLFYVSFTNTAIKYATV----IVTYVANTVHFEAINQRCTMQRTH 126

  Fly   133 ------------KLDYRRILLSSF-LISLGMLLFNVIYLCVSYSLLVSATISPSFVTFTTFALPH 184
                        |..:...:...| ||:| |::..|..:...|..:...::|...|.|..:|...
  Fly   127 LEFEFKNAPQEPKRPFEFFMYFKFCLINL-MMMIQVCGIFAQYGEVGKGSVSQVRVHFAIYAFVL 190

  Fly   185 IN-----------ISLMVFKFLCTTDLARSRFSMLNEILQDILDAHIEQLSALELSPMHSVVNH- 237
            .|           |:..|.|:.       .:|::....|:|.:|.         |.|...:::| 
  Fly   191 WNYTENMADYCYFINGSVLKYY-------RQFNLQLGSLRDEMDG---------LRPGGMLLHHC 239

  Fly   238 ----------RRYSHRLRNLISTPMKRYSVTSVIRLNPEYAIKQVSNIHNLLCDICQTIEEYFTY 292
                      ||....:.:|.....:.:.. .:|.|.....|..::|.:.|...:.:...|..:|
  Fly   240 CELSDRLEELRRRCREIHDLQRESFRMHQF-QLIGLMLSTLINNLTNFYTLFHMLAKQSLEEVSY 303

  Fly   293 PLL--GIIAISFLFILFDDFYILEAILNPKRLDVFEADEFFAFFLMQLIWYIVIIVLIVEGSSRT 355
            |::  .:.|..|    :.|.||:..|....:|::                               
  Fly   304 PVVVGSVYATGF----YIDTYIVALINEHIKLEL------------------------------- 333

  Fly   356 ILHSSYTAAIVHKILNITDDPELRDRLFR----LSLQ-LSHRKVLFTAAGLFRLDRTLIFTITGA 415
                   .|:...:....:..|:.:||.|    |||: |:::..:.  .||..|||.|::.|...
  Fly   334 -------EAVALTMRRFAEPREMDERLTREIEHLSLELLNYQPPML--CGLLHLDRRLVYLIAVT 389

  Fly   416 ATCYLIILIQF 426
            |..|.|.|:||
  Fly   390 AFSYFITLVQF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr28aNP_523504.2 7tm_7 22..430 CDD:285581 79/401 (20%)
Gr10aNP_727523.1 7tm_7 20..402 CDD:285581 79/401 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.